+ Reply to Thread
Page 7 of 23 FirstFirst 1 7 17 23 LastLast
Results 121 to 140 of 446

Thread: The Serpent, the Black Sun, HPB & St. Germain

  1. Link to Post #121
    Avalon Member blackdog's Avatar
    Join Date
    24th July 2016
    Posts
    232
    Thanks
    50
    Thanked 589 times in 170 posts

    Default Re: The Serpent, the Black Sun, HPB & St. Germain

    Quote Posted by Cartomancer (here)
    You can see plainly that the Freedom Tower is an octagon from plan view. If you want to interpret it as a hexagon be my guest. The hexagonal structure in this scheme is documented as well. There is no hexagon or hexagram as you claim visible at the Freedom Tower. There is an octagon that is plain to see. There are even eight of the triangular forms you suggest and not six. Sorry if this does not jive with your analysis. You seem to have it all figured out so why ask? No. I have not found a single unifying group of people who practice this activity. They often do it in opposition to each other as well. In fact the record shows it being lost and rediscovered at various times. My studies show what the 'shadow government' really is and is has nothing to do with the "white brotherhood" or any other such concept that has no basis in reality. The Nazi's got punked and used in a big way with this kind of information if you ask me and there is only one group that is that good at pulling things like that off.
    Where are there any equilateral triangles as contained in a hexagram here? The difference between eight and six in the Catholic and Jewish faiths is significant. Thank You.
    The midsection is shaped like an octagon. I am not disputing that. There are eight sides, although the completed tops and bottoms seem to be squares. Still, I'm not disputing the eight sides.

    I am saying that the sides are clearly triangular. Imo, this is a reference to the hexagram, which is used in Freemasonry to represent the union of oppositions that leads to higher consciousness. The two towers or pillars are used as symbols of the oppositions when separated. These oppositions have been united at the World Trade Center.

    The building does not look like a hexagram or hexagon. It represents a hexagram through these up-and-down triangles. One tower replaced two. They were unified.






    From http://en.wikipedia.org/wiki/Hexagra...in_Freemasonry:
    "The interlacing triangles or deltas symbolize the union of the two principles or forces, the active and passive, male and female, pervading the universe ... The two triangles, one white and the other black, interlacing, typify the mingling of apparent opposites in nature, darkness and light, error and truth, ignorance and wisdom, evil and good, throughout human life." – Albert G. Mackey: Encyclopedia of Freemasonry

    "The hexagram, one of the world's most ancient symbols, is featured within and on the outside of many Masonic temples as a decoration. It may have been found within the structures of King Solomon's temple, from which Freemasons are inspired in their philosophies and studies."



    There is a network out there strong enough to build all these symbolic buildings in preparation for a large symbolic event and then cover it up enough to avoid prosecution or public uprisings. Imo.

    I agree with your information and see it as consistent with what I am saying.
    Last edited by blackdog; 19th October 2016 at 12:24.

  2. The Following 3 Users Say Thank You to blackdog For This Post:

    Eram (16th December 2016), Flash (28th December 2016), Vernaianawa (5th March 2018)

  3. Link to Post #122
    United States Avalon Member
    Join Date
    1st April 2016
    Posts
    1,494
    Thanks
    2,090
    Thanked 4,783 times in 1,266 posts

    Default Re: The Serpent, the Black Sun, HPB & St. Germain

    I haven't been able to focus for a while. Firstly, some quite bad things happened, and then I wound up having to deal with some new animals: six free range chickens and a goat. The goat is a Nubian kid, a living replica of "Baphomet". His pen wound up beside a large fire crater I had made. I got him accustomed to fire and then sacrificed an entire Alice Bailey collection and several pounds of Lucis stuff in the flames before him.

    The hexagram also represents the mysterious or hidden seventh principle--implied by way of omission.

    I am convinced there is a network strong enough to archive virtually all of the world's teachings (correct ones and otherwise) and to keep its yoga practices mostly concealed, like the "seven" in the hexagram. They create a few buildings, mostly monasteries, which have a certain architectural feature: a dark room on whose north wall is a highly polished sheet of copper alloyed with a few other metals. Before this, the subject sits on an insulated stool in a glass bowl; a large magnet is suspended over his head, with the north pole upright.

    Brotherhood of Khelang

    This was a weird term that crept up a few times in reference to the Trans-Himalayan Lodge. As written, it's almost meaningless. But, from a late article "Tibetan Teachings", we have the same occult principles repeated by someone who both has an official duty in a Buddhist monastery, and must have got them by some degree of initiation. He makes a Biblical reference, learned in "the missionary school at Lahoula".

    There were many government schools, but only one missionary school (Moravian) started in Lahaul in 1856--this must be where the Tibetan went. It is in a town variously spelled Kyelang or Kyelong, but, prior to any standardized spellings, it could easily be written Khelang. Lahaul and Spiti is the modern name for Tibetan frontier districts in Himachal Pradesh; very sparsely inhabited, site of some of the only surviving Buddhist monasteries in India, which are very old, and known for housing hundreds of secret texts.

    They collect and read plenty of Western material as well. At one point, Koothoomi even praised Baron D'Holbach (Essais sur la Nature)--an Encyclopedist and Materialist. He wrote under the names of Mirabaud and other dead people because, at the time, to come out as an atheist was to invite disaster. Although in his later works he wrote things like the soul is a tabula rasa/blank slate, which doesn't fit with occult doctrine, in this early bit, what he said that "clicked" was: that thought is one of the properties of matter.

    In French: https://archive.org/details/essaisurlanatur00collgoog

    One of the more influential hands on theosophical movements in general was Pico della Mirandola. In an earlier post, we found some small town in Italy where he claimed to have discovered genuine magical lore. Most likely, one of those manuscripts was:

    The Chaldean Oracles of Zoroaster

    He said he had an authentic article, much better than the known Greek versions which were incomplete. This was hugely influential to Theosophy; Thomas Taylor translation: http://www.masseiana.org/chaldean_oracles.htm

    As well as to the Golden Dawn: http://www.esotericarchives.com/oracle/oraclez.htm

    Theosophy never made use of the Tarot as the Golden Dawn did; HPB simply said its key was to be found in the Chaldean cylinder seals in the British Museum and other places. I haven't figured that one out yet--maybe this text is related--there are so many of those seals, kind of hard to tell where to look.

  4. The Following 6 Users Say Thank You to shaberon For This Post:

    Cara (13th November 2016), Eram (16th December 2016), Flash (28th December 2016), fourty-two (19th December 2016), Vernaianawa (5th March 2018), Zampano (13th November 2016)

  5. Link to Post #123
    United States Avalon Member
    Join Date
    1st April 2016
    Posts
    1,494
    Thanks
    2,090
    Thanked 4,783 times in 1,266 posts

    Default Re: The Serpent, the Black Sun, HPB & St. Germain

    Marga

    Sanskrit for Path, used by Buddha to describe his philosophy. He was a person sometimes described as omniscient, but occultly, what it means to say he had a cosmic consciousness, is that he could be fully conscious speaking in his physical body, and at the same time be fully conscious in buddhi on some interstellar world. The average human being will achieve this capability at the end of the sixth round. HPB said the main thing that was different about her than us was that during sleep, she remained fully conscious. So those are simply stations along the path, from one we can form a fairly solid concept of (astral clairvoyance), to one we can scarcely imagine (transcendance of the planet).

    Most of the sages stories such as Orpheus, Krishna, Jesus, and so on, contain a solar god passing through an underworld experience, a labors of Hercules event. Those are stories of initiation and twelve zodiacal trials. The average person does not pass. Out of all the personages from the literature, Damodar is the only one to have known the whole secret and gone to live with the masters. C. W. Ledbeater was a chela but was dropped for serious reasons. Annie Besant was rejected for being "too intellectual". Alice Bailey came to Theosophy in 1917 having had nothing to do with it. Numerous points have been made on her Djwhal Khul, but there's a pretty straightfoward one about Koothoomi. When she saw his portrait she simply "recognized" him as the person who, when she was fifteen (1895) lying in bed depressed, in Manchester, he just walked into her room and told her that she could work for him if she quit being a brat.

    That was it.

    In his own handwriting, Koothoomi states that to find HPB, the chiefs searched Europe for almost a hundred years. They had given, at least, certain ideas to Paracelsus, Robert Fludd, Thomas Vaughan...and then took almost a hundred years finding someone to write for them...something that itself was all that was to be said for another two hundred years.

    He quit communicating with foreigners in 1885.

    Post-World War I was the only time he was heard from again. B. P. Wadia stood up against the Triumvirate Ledbeater, Besant, Bailey, who opposed him, and he set off on his own. In 1919, in some effort to heal the British nation, Koothoomi once again was willing to make contacts to Dion Fortune and others via Mr. Wadia--and her reaction is probably typical. The ideas are too strange and so she goes off to form another pseudo cult with the shining presence of Master Jesus and so forth. It's basically the same time period that the "Tibetan" starts, causing the Baileys to start Lucis Trust. None of those people represent a hundred year search. Nor does he sound like the type of person to be popping around Manchester just to astonish someone.

    Bhavani Shankar, who had personally met the master, described their teachings as blasphemy, dragged down into modern ignorance.

    Not all of the Indians were successful as chelas. Mohini Chatterji was in for a few years, but, during a European tour, apparently the attention of women plus a general attitude of praise and putting him on a pedestal filled him with too much grandeur. This would be one of the Zodiacal trials or labors where he was unsuccessful.

    He did, however, describe what gained him initial consideration and acceptance into discipleship for a few years.

    Nowhere do we have a particularly detailed explanation of what the degrees of discipleship or mastership are, or what an initiation consists of. That is Ledbeater-craft.

    Chatterji instead used classical Brahminical texts to explain the four sadhanas (accomplishments).

    The first accomplishment is right knowledge of the real and unreal. This is the purpose of esoteric philosophy.

    The second accomplishment shows as indifference to the enjoyment of the fruit of one's actions. However, this does not mean a forced repression of all desires, which is to be avoided. It must develop from within. The way to reduce the chains of karma is to let all that energy dissipate generically into the cosmos without coloring it through one's self. At this point one can be enjoined to duty.

    The third accomplishment has six qualifications.

    Sama breaks up the law of association of ideas in the mind; the imagination becomes purified and consciousness is controlled.

    Dama is the control of bodily acts as the result of mental control.

    Uparati is the renunciation of all formal religion.

    Titiksha is a constant readiness to part with everything worldly, as for example not to cling to resentment against wrong. This erases care and leads to cheerfulness.

    Samadhana comes to an inability to deviate from doing the good or just thing. No lower ego interferes with the person and they are completely reliable for tasks, duties.

    Sraddha is then complete confidence in a master's ability to lead or teach--as, not necessarily the final or ultimate authority, but the most reliable guide; senior with proven ability.

    The final accomplishment or mumukshatva, is seeking liberation from conditioned existence and to move into One Life.

    That is how Chatterji explained the qualifications and tracking of the stages of probationary and accepted discipleship. Koothoomi invented a thing called "lay chela" for A. P. Sinnett, which translates more or less into the terms that the general public is able to progress along the first accomplishment, which, in terms of karma and reincarnation is eighty times as powerful as formal religious activity.

    The Indian Trans-Himalaya is actually on its way to gaining a unique status in the world:

    http://whc.unesco.org/en/tentativelists/6055/

  6. The Following 8 Users Say Thank You to shaberon For This Post:

    Cara (12th December 2016), DNA (19th January 2017), Eram (16th December 2016), Flash (28th December 2016), fourty-two (19th December 2016), Foxie Loxie (11th December 2016), Vernaianawa (5th March 2018), Zampano (2nd January 2017)

  7. Link to Post #124
    United States Avalon Member
    Join Date
    1st April 2016
    Posts
    1,494
    Thanks
    2,090
    Thanked 4,783 times in 1,266 posts

    Default Re: The Serpent, the Black Sun, HPB & St. Germain

    Small note to link some local, independent testimony about the Trans-Himalaya:

    http://projectavalon.net/forum4/show...79#post1120879

    Some of the folks have been there, and it sounds quite corroborative.

    I figured out one of William Judge's mistakes about St. Germain: he had mixed up Louis XVI's Minister of War, Claude-Louis, Comte de St. Germain, with the otherwise nameless adept. It's a fairly common name and place name, but Claude-Louis was a totally different person, whereas the mystery man probably held a title to one of the many San Germanos in Italy.

    The thing that made A. P. Sinnett relevant was his humility and sincerity. He had written "The Occult World" and "Esoteric Buddhism" out of his early understanding of this ethos. The many letters then exchanged, primarily with Koothoomi, and only a few with Morya (whose pet peeve was the fact that he hated writing) were an attempt to straighten out the errors he published in those books. And he was one of the few who never tried to bash the masters or to fit what they were saying into something acceptable to the church. On the one hand, these letters were never authorized to be published in their entirety, but on the other hand, he was allowed to quote from them verbatim without attribution.

    In his last days, Sinnett was attended by a fairly unknown lady named Maud Hoffman, who became the beneficiary of his estate. She transferred the letters into the hands of Trevor Barker, who decided to publish them all and then drop them into the British Museum. There are no reasons recorded why he decided to do this, but, considering he did so around 1924, this was just a few years after people like Fortune and Bailey started "their thing", so perhaps it was a small countermeasure.

    What tripped me up personally was that I read them in the same time I was getting into the Bailey books. Of course, I assumed that Alice must have been thoroughly familiar with them, and that, therefor, her material must have been some kind of a ruse or ploy to get the attention of the general public by making it religiously appealing. However, this is a complete contradiction to what the letters themselves say, and in retrospect, she could not have seen them until after putting out a few books of her own (or whoever they really came from).

    The Stanzas of Dzyan in their modern (Indian-Tibetan-Chinese) form are said to be only about 1,000 years old, roughly the same as Tabo Monastery in Spiti. They are extrapolated from the core text in Senzar. This unknown language is written completely in symbols; and so, in the same way, the symbol "5" can be read in many languages, so can they. Without the correct key and commentary, it's utterly meaningless; Tibetans say their codes make the Rosicrucian ciphers look like child's play.

    One of the primary ways a master "announces" his approach is by a targeted electrical current of willpower, from miles away. It's targeted so that, for example, if the chela is in a crowd of a hundred people, he will be the only one to feel it. I am not sure what kind of battery this is in reference to, but, apparently, the current you can feel by bridging some battery terminals is "nothing" compared to this greeting from a distance. Now, if you have the ability to do that kind of thing, I would not think it difficult to turn it up to the point where your target roasts as if in an electric chair. Another reason why the true secret formulae, etc., are not thrown out for public consumption.

    Aside from such dangers, the Brotherhood is only interested in free will and moral strength. Their science is a bit different not only because of realizing matter is related to consciousness, but also, they question whether something like memorizing Faraday's Law is of any lasting moral value. That is really the main criterion in judging things or in deciding to take a course of action. Hence, they do not come out to take over or save the world, as that would be opposed to a person freely developing their own moral strength.

    Without any inner dedication like that, then the philosophy of Hobbes, Machiavelli, or even Anton LaVey is correct.

  8. The Following 6 Users Say Thank You to shaberon For This Post:

    Cara (17th December 2016), DNA (19th January 2017), Eram (16th December 2016), Flash (28th December 2016), fourty-two (19th December 2016), Vernaianawa (5th March 2018)

  9. Link to Post #125
    United States Avalon Member
    Join Date
    1st April 2016
    Posts
    1,494
    Thanks
    2,090
    Thanked 4,783 times in 1,266 posts

    Default Re: The Serpent, the Black Sun, HPB & St. Germain

    So, it wasn't a very deep dig, but in making a publication of all A. P. Sinnett's stuff, Trevor Barker hadn't done much new. The original Mahatma letters were copied and sent around to Adyar and other lodges, and the ones related to teachings were published as "Letters from the Masters of Wisdom" around 1888. Koothoomi's first letter in 1870 was to HPB's aunt to let her know she was still alive--written in French. The reason Russians would understand French relates to the older potential alliance, which, might not have solved all the world's problems, but, was aware of and opposed to central banking. This letter was delivered by a messenger of Asiatic appearance, who vanished before her eyes.

    He was fluent in French, English, and possibly German, as he had western education; however, attempts to place him at a given university and thus identify him, probably don't hold water. From an interaction with M. Gebhard in Leipzig, who knew a student called Niisi...last name is too complicated...that person turned out to be an ordinary individual who held a regular office job in India. So not the same. Koothoomi is of course a generic name from the Vedas, and so he is also not the same as the leader of the Koothoompas, a sect of specialists in herbal medicine.

    I take his actual, personal writings to be a step above HPB, whom he described as "her mental furniture is very chaotic, when she tries to express an idea, the tail emerges first and the head only later". HPB had kind of denounced the Bardo Thodol, Tibetan "Book of the Dead" (actually: Liberation by Hearing in the after-death Plane) on the basis that firstly, the dead can't hear anyone talk, and also, it doesn't literally last forty-nine days. Both points are probably true, nevertheless, Koothoomi validated the three after-death Bardo as states the "knower" passes through. I took them to be highly symbolic, in other words (making this up slightly) where it says you find a blue elephant-headed deity with six arms, well, that's probably true if you are Tibetan raised with that image in mind, otherwise, such a deity might look a little different. So I don't think those literal depictions are necessarily 100% accurate, but in essence, the process described, is very much what happens to everyone. If everyone reads Bardo Thodol, I think we will have a different dynamic in life.

    Djwhal Kul is not a generic name. Very weird. In an unrelated search, one time I saw "djwhal" as meaning an irrigation canal in some Indian language, can't remember which. No one really knows what that's about. Sometimes it started with a "G". One thing we do understand, is his other nickname, "The Disinherited"--he was from an orthodox Brahman family who kicked him out when they realized he was dedicated to the Trans-Himalayan Lodge. Sometimes he also used the Biblical "Benjamin" to refer to the same thing. He was the one who appended "Lal Singh" to Koothoomi (maybe two times), which the master later said shouldn't have been allowed; "Lal" means a chieftain, and "Singh" is the male Sikh surname (lion).

    Sinnett asked some questions which Koothoomi refused to answer, as they pertained to high initiations, such as the special relation of Mercury and Mars to us. Flat out refused to answer the guy on several instances like that. Now, I'll admit the teachings on chains/rounds etc. already get so intricate my head swims. I am the type of person that, given the basic idea, yes, it expands the mind and makes me act differently than either materialistic death = end, or religious one life determines eternity, but I tend to agree that past those basics, no further details would really do me any good.

    Ledbeater said he psychically saw Martian people. The accumulated wisdom of generations of accepted clairvoyants says: Mars passed to pralaya, in other words, the last people finished their lives and currently no one takes birth there. That doesn't mean that Ledbeater didn't actually see something, but it does mean, most likely, his vision was not clear. Another "serpent" interpretation is simply the undulatory motion of astral light, it can be very much like heat waves in the desert, and distortions and mirages are what will mostly be found without complete training.

    Anyone can enter the first qualification (esoteric philosophy to distinguish the unreal from the real) and anyone can pass seven years probation anywhere. But that is a lot to ask. It will flush out all your potential karma, and you will be watched on twelve Zodiacal trials. I tend to think of these as the elements (earth, air, water, fire) in each mode (cardinal, fixed, mutable). It's not something you "just do" because you're a good person, or have expanded your mind or have a few astral experiences. It's something that may drive you insane or ruin you utterly. So it should not be desired just because it sounds interesting, or you think you have a knack for it. You'll have to eat all your shadows, to say the very least. Ultimately they are only going to take someone as pure as a small child. Others may be different, but I couldn't pledge I'd live like that for more than a few hours at a time; nevertheless, I'm much more happy as a "lay chela" than as someone who had never had a chance to hear.

    Nirvana (Buddhist) or Moksha (Hindu) can be achieved more or less by virtue alone. It will essentially remove one from incarnation until the next round. The path described by the Trans-Himalayans is that of the bodhisattva, one who knows and can reach nirvana, but refuses it and intends to return to earthly life. That's a pretty strong commitment, never without peril, and, no matter who, when born on earth it still takes seven years to even gain a hold of the brain/body--that is why yogis sometimes look for a dying or dead person, to inhabit a body that is already "ready to go" instead of repeating infancy. It takes some power to do this; Koothoomi once stated he had been over nine days on horseback without dismounting. Not only does that require supreme yoga over one's own body, but--that of the horse as well!

  10. The Following 5 Users Say Thank You to shaberon For This Post:

    DNA (19th January 2017), Flash (28th December 2016), fourty-two (8th January 2017), Shannon (18th January 2017), Vernaianawa (5th March 2018)

  11. Link to Post #126
    United States Avalon Member
    Join Date
    1st April 2016
    Posts
    1,494
    Thanks
    2,090
    Thanked 4,783 times in 1,266 posts

    Default Re: The Serpent, the Black Sun, HPB & St. Germain

    Etheric Body

    This is apparently a Besant-ism which subsequently proliferated across all the branches and offshoots of altered teachings. It states that the upper sub-planes of the physical plane house a distinct, separable body of consciousness. This is not the original doctrine. The term "ethereal" was frequently used, not as a stand-alone, but in a fairly ordinary meaning of more subtle, less dense.

    Raja Yoga describes only four possible vehicles for consciousness (physical, astral, mental, buddhi), which would seem to be a contradiction to the occult doctrine of seven principles of consciousness.

    The explanation goes somewhat like this. The seven subplanes of the physical plane, at least in part, completely match academic science: solid, liquid, gas, plasma. Next is the hypothetical "ether" of science, and the highest two not particularly defined, but mostly inferred to range from the senses up to the highest intellect. None of that is distinct or separable from the physical body--it is the body and/or what it can perceive (not even having developed its highest physical senses yet).

    The confusing part is that "astral" really refers to three entire planes. The lowest or "linga sharira" means, a model. Everything in the physical world exists because it is modelled here. Hence, the human body has an astral double, as does the plasma body of the sun. If I chop off my hand, it's because I did so in the astral plane, and that double will lose its hand. Correspondingly, the double itself may get damaged, and this will be replicated on the physical body. It has a very minor amount of independence from the physical body.

    The "middle" plane of the astral world is that of prana, the chakras, etc.--so there is a full set of senses that pertain to this plane, only, which again itself exists by seven degrees or sub-planes. *Both* prana and linga-sharira are typically taught as being the "etheric body", whereas they are two entire planes.

    The "higher" astral plane is that of kama-manas or "desire-mind" whose subplanes span from instincts up through almost all the thinking we do. This body is somewhat of a double, but it is more ethereal, more plastic. If I chop off my hand, because I am instinctually and habitually accustomed to having the hand, the desire body will still have that hand. So this is the source of "phantom limbs". The body in general defaults to look like one's self, however, if concentration is developed, one could become taller, shorter, wear clothes of the 16th century, sprout tentacles, or turn into a penguin. This plane or kama-loka is where thoughts produce images and where there are things "only" on the astral plane like hells or paradises. On this plane are experienced the full "projections" that can include flight, long-distance travel, etc., and it may precipitate effects to the lower planes. The astral may have three whole planes or sets of perceptions, however, kama-manas is the consciousness inhabiting them all--so there is only one astral vehicle of consciousness.

    Higher mind (manas) and buddhi each have whole planes, and the highest, atma, is neither a vehicle nor a distinct state of consciousness. "Spiritual" means that which releases consciousness from kama-manas and directs it to manas. The manas is the ego in its original Greek meaning of "true individual", it is the reincarnating jiva, it is the immortal vessel for the duration of a manvantara or planetary round. It is not personal, it is the impulse behind each birth, mixed with whatever it may gain from one lifetime to add to the next. The three higher planes are "formless" (arupa) so it is impossible to describe manas as a double or to attempt to describe the nature of time or dimensions, which would be established by thought alone, and not bear any resemblance to physical structures.

    Besant-isms added the misleading concept of entire planes/bodies for "higher mental" and "causal". In occultism, there is no difference. Reflect on this a moment. The pseudo-teachings make an overly elaborate big act about building the "antahkarana" or "Bifrost rainbow bridge" so that your mortal, personal higher mind can link to its immortal causal body. Occultism dispenses with this completely, because the higher mind (manas) is the immortal, impersonal and causal. That's much more tangible to me. I can quickly and easily picture what kama-manas is, both on its own plane, and the fact of it being 99% of what I imagine to be my own mind. To become spiritual is an immediate, direct switch "above" it. Nothing particularly abstruse to learn, build, study, or any of that. It's not very easy to do, but it's a lot simpler and more elegant than all the "additions" make it out to be. Thus they interfere with/slow down spiritual progress by changing descriptions of the "etheric body" and the causal.

  12. The Following 5 Users Say Thank You to shaberon For This Post:

    DNA (19th January 2017), Flash (28th December 2016), fourty-two (3rd January 2017), Shannon (18th January 2017), Vernaianawa (5th March 2018)

  13. Link to Post #127
    United States Avalon Member
    Join Date
    1st April 2016
    Posts
    1,494
    Thanks
    2,090
    Thanked 4,783 times in 1,266 posts

    Default Re: The Serpent, the Black Sun, HPB & St. Germain

    Genesis

    With this book, right from the very start, we can find the esoteric doctrine very easily--even though, in English, the translation usually offered is basically an opposite. The familiar and almost exclusively-used version comes out something like this:

    In the beginning God created the heaven and the earth. And the earth was without form, and void; and darkness was upon the face of the deep. And the Spirit of God moved upon the face of the waters.

    Here, you have a singular, male entity, named by a 5th century Gothic word, who starts time and created the world out of nothing. This does not agree with the ancient systems. Moreover, it depends on the Masoretic interpretation of "Biblical Hebrew". Masoretic is a school of interpretation stemming from the placement of vowels and separation of words. The ancient Hebrew scriptures had no vowels (besides aleph) and letters were written in a continuous stream. So, for example, those first two lines would have read:

    nthbgnnnggdcratdthhavnandtharthandtharthwswithtfrm andvdanddrknsswaspnthfacfthdpandthsprtfgdmvdpnthfa cofthwatrs

    Accordingly, ancient written Hebrew pretty much requires interpretation to get meaning out of it.

    The closest word for a singular male god was El, with a goddess being Eloh. The term used in Genesis, Elohim, is plural, with the somewhat unconventional use of the masculine plural (-im) instead of a feminine (-oth). Instead of "god", Elohim indicates more of an "androgynous host".

    From Masoretic Hebrew, the first sentence was translated from:

    B’râsh ithbara Elôhîm eth hashamayim v’eth h’arets

    However--without breaking any rules, one can get sensible Hebrew by simply moving the very first space:

    B’râ****h bara Elôhîm eth hashamayim v’eth h’arets

    This arrangement dispenses with any notion of a "beginning" or a "creation". Instead of "In the beginning God created", it comes out more as "In the source, the androgynous host shaped". So by these two simple things, we have moved away entirely from the common rendering to the esoteric philosophy. Uncreated, permanent matter merely being shaped by a host of intelligent forces. This "host" being recognized widely by ancient cultures, at one time understood as "The Grand Architect of the Universe", that same phrase later used by Masons to intercept any monotheistic creator so that people of different religions could all participate.

    The English text is irreconcilable, but combing through the original will yield a close match to the Zoroastrian, Chaldean systems and so forth. This process is speaking of the Third Logos, the "Seven-Rayed", the first two having basically nothing to do with the formation of world-systems.

    Not much further in Genesis, we stumble on the untranslated "Nephilim". This certainly does not work out as "Fallen Angels" if there is no malakim/cherubim/seraphim included with it. It's fairly close to just "fallen (ones, things)" although that would not quite be grammatically correct. It does essentially match Aramaic "Nephilin" meaning "giants", with most of the Aramaic loan-words swapping the final "n" for an "m" as the Hebrew plural.

  14. The Following 8 Users Say Thank You to shaberon For This Post:

    CD7 (4th January 2017), DNA (19th January 2017), Flash (2nd January 2017), fourty-two (3rd January 2017), Shannon (18th January 2017), Vernaianawa (5th March 2018), YoYoYo (6th January 2017), Zampano (2nd January 2017)

  15. Link to Post #128
    United States Avalon Member
    Join Date
    1st April 2016
    Posts
    1,494
    Thanks
    2,090
    Thanked 4,783 times in 1,266 posts

    Default Re: The Serpent, the Black Sun, HPB & St. Germain

    The Assassination of Tsar Alexander II -- World's First Suicide Bombing

    (1881) This was committed by a group called "People's Will", more or less a forerunner of the Bolsheviks; an outgrowth of Land and Liberty and part of what Russians class as Nihilists. Russia of course had its share of assassinations, all basically cloak-and-dagger style; however, the way this took place in broad daylight in public was a complete outrage.

    It was not quite what we think of as suicide bombing today with a belt or something like that. The fact was that these old bombs were simply too heavy to be thrown very far. These times were also the beginning of Okhrana (secret police), who had already infiltrated groups and made various arrests, and there had been failed attempts on Alexander II already.

    Well, the "People's Will" wasn't quite what the name represents; they had no experience, no particular connections to society, they were basically all under thirty years of age, half of them younger than twenty-five. Radicalized students with Swiss and British notions who sought to impose reform by terrorism. The acting group in this bombing was soon arrested.

    The "signal lady" of the attack was Sophia Perovskaya. She was related to nobility and could have obtained pardon but offered herself for trial. The proceedings of the trial were censored to the public, so most historical records don't have a whole lot to say about her. Being Russian, HPB was able to "backchannel" what took place.

    Sophia went through it with an amazingly snotty attitude. She had told the police they could neither discover nor stop the plot. In court, she laughed at them for how easy it was to pull off. She laughed at the government. She laughed at the church. Eventually the judge asked her if there was anything she was not going to laugh at. Sophia became serious and said "the people".

    The court convened and when they came back, the judge gave a decision. He told Sophia, look, since you're their champion and love them so utterly, your sentence is: we're giving you to the people.

    At that point, Sophia broke down, saying torture me, kill me, do whatever you want, but please don't ever give me to the people!

    She knew fully well that the people didn't like their government, but they hated terrorism above all, and that the bombing was a pure insult to the typical Russian sensibilities. The court succumbed to her plea and hung her with the rest.

    People's Will was a foreign-inspired, large group with mining operations and other industrial capacities and grips of cash. I don't know if it was "trendy" at the time, but HPB said that nothing like that was possible without the assistance of a Rothschild banker. Statement made by the same person who attacked the pope's army in a regular battle, suffering two musket balls which remained in her body, an arm broken twice by a saber, and then a stiletto right under the heart. Practically dead at that point, which was the first time Morya patched her up.

    Towards the end of her life, I'd guess her nephritis was treated with Tibetan Hogweed.

    This act and Sophia's drama are another illustration that patriotic Russians have known of, and opposed for a long time, central banking and its employment of wanton destruction. Not saying the Tsars were saints, but street violence spreads like wildfire, especially when someone is pouring money in it. The American and (first part of the) French Revolutions were directed against military targets, much more just than an outburst of angry mass murder.

    And so, yes, Russian intelligence was specifically formed to combat foreign bankers' terrorism.

    In that they were overwhelmed and things happened, this seems to have been largely handled by Jacob Schiff and others of that ilk.
    Last edited by shaberon; 29th September 2018 at 01:36.

  16. The Following 5 Users Say Thank You to shaberon For This Post:

    DNA (19th January 2017), Eram (2nd January 2017), Flash (2nd January 2017), Shannon (18th January 2017), Vernaianawa (5th March 2018)

  17. Link to Post #129
    United States Avalon Member
    Join Date
    1st April 2016
    Posts
    1,494
    Thanks
    2,090
    Thanked 4,783 times in 1,266 posts

    Default Re: The Serpent, the Black Sun, HPB & St. Germain

    Narayan

    This "revered Old Gentleman" appears to have been dealt the biggest case of revisionism and conflation of anyone the Founders spoke of, and again illustrates the difference between "the adepts people believe in, and the ones we personally know".

    In India, the theosophical headquarters were placed in Adyar, a suburb of a city then called Madras, now Chennai, in the state of Tamil Nadu. The Founders said that one of their Mahatmas was living within 100 miles of the location. He was one of the only ones said to have an "elderly" appearance. He was the one that Col. Olcott developed the closest personal ties to, and was also known by HPB and Subba Row. They initially met at a party in Pondicherry. Narayan had helped create Isis Unveiled and never showed a whole lot of written activity, although he did refute Swami Dayanand Saraswati in a letter signed as being from "the Tiruvallum Hills".

    Since English spellings of these words were not then standardized, it's kind of hard to tell where that was. There is a place with a similar name in Kerala, which can get confusing as among the later "aliases" given to him was "sage of the Nilgiri Hills" which are in the Western Ghats and where Olcott had a retreat built in 1890. But more precisely, in the founding days he actually lived near Arcot, a suburb of Vellore and was even a landowner there. The "Tiruvallum Hills" would therefor be part of the Eastern Ghats and near a place that is now spelled, at least on Wikipedia, as Thiruvalam. This is approximately 100 miles from Adyar.

    C. W. Ledbeater (who probably did meet him one time) said Narayan was "Jupiter" and the "Regent of India". Annie Besant later claimed contact with the Vedic "Rishi Agastya" who was the "Regent of India". And so Alice Bailey wound up with something like "Master Jupiter, the Sage of the Nilgherry Hills, the Occult Ruler of India".

    It is hard to say right offhand who "Rishi Agastya" was, that gave Besant a note she kept in her pocketbook for the rest of her life. Historically, thousands of years ago, the Vedic personage had invented things like batteries and electroplating. Recently one person attempted to pursue these recipes and was forced to irritate a bird farmer because he needed the "neck of a peacock". While he was waiting for such a bird to die, he happened to mention this to an Ayurvedic doctor who burst out laughing, because it doesn't literally mean a bird's neck, it means something of the same color: copper sulfate.

    HPB never said he was responsible for the destiny of India, it seems that Ledbeater's "changes" then got folded in with whomsoever Besant was talking about, and again with Alice Bailey the dish ran away with the spoon. Narayan's published letter is simply a repeat of the identical philosophy given by HPB, the Masters she personally knew, and the chelas who were also involved. Due to the effective publishing power of "vested interests", I'd estimate I've known the "Master Jupiter" story for twenty-five years, versus the historically-based Narayan for about twenty-five hours.

    Yes, his participation in creating Isis Unveiled was by psychic means, but as with all cases of those that HPB communicated with clairvoyantly, they have all been human beings verified by multiple other people.

  18. The Following 5 Users Say Thank You to shaberon For This Post:

    DNA (19th January 2017), Flash (4th January 2017), pueblo (19th January 2017), Shannon (18th January 2017), Vernaianawa (5th March 2018)

  19. Link to Post #130
    United States Avalon Member
    Join Date
    1st April 2016
    Posts
    1,494
    Thanks
    2,090
    Thanked 4,783 times in 1,266 posts

    Default Re: The Serpent, the Black Sun, HPB & St. Germain

    The Todas of the Nilgiri Hills

    These people are perhaps the most mysterious tribe you'll never hear about.

    So Olcott had built a retreat there at Ootacamund (Ooty). Annie Besant and B. P. Wadia were actually placed in house arrest there for about three months by the British, due to their involvement with Indian Home Rule. Wadia himself obtained 100 acres about four miles out of Ooty on the Old Mysore Road, a property he called Gurumandir.

    As to his personal integrity, he quickly resigned from his first job as a young man with a British textile firm. They expected him to lie in the course of business, which he refused to do. He formed India's first workers' union, the Madras Textile Workers' Union. The British actually summoned him to England in 1919 in response, which for him launched his first European tour, and for them resulted in a piece of legislation called the Montford Reform Act of 1919. Ms. Besant later confirmed to him privately some things like W. Q. Judge had been "wronged", but refused to change anything on public record.

    Narayan, as mentioned above, only has one personal letter sent to Olcott (Letters from the Masters of Wisdom contains this and the Serapis Letters). All it is, is a short note which tells him, I believe with reference to A. O. Hume: you must not let him believe even for the twinkling of an eye that you are a Christian or that you may be one. Again, not a great match for the "Master cult" that developed, but so says the "Sage of the Nilgiri Hills".

    The Todas inhabit the hills near Ooty, and their population amounted to some 550 men and women, no children. They are ascetics, with some unconventional habits like only drinking milk. Most people in south India are short and dark. The Todas are tall and light, appearing more like Greeks. They are served by a neighboring tribe called Badagas. According to HPB, children seen with them are Badagas--this tribe voluntarily offers them food, clothes, etc. The Todas don't actually beget children. They are not a "real" tribe in the sense of a group of families. It is a sect whose members are discovered at birth elsewhere and delivered to them. She said that basically everything believed about them by explorers and missionaries was a false rumour.

    HPB said that, with the encroachment of civilization, the Todas had retreated into even more remote places, and B. P. Wadia agreed and added that they had even substituted "look-alikes" for themselves for foreigners to discover. As for the role that they play or what kind of sect they are, he said it was to mitigate or suppress the evil of the Mulla Kurumbas.

    Kurumbas are another local tribe of much greater number, with various branches; Mulla referring to a "net", presumably one used for trapping game. So, to look at a non-Theosophical source to see what that might be about, we can for example see:

    http://factsanddetails.com/india/Min...ntry-4217.html

    Which gives us the following tidbit (spelling errors included): "The Kurumbas have a reputation of being sorcerers. Traditionally, the Badaga hired an individual Kurumba man who act as hraduan for a specific villages. This was a lifelong job that was passed down from father to son. This individual over agricultural festivals and was employed as a diviner, exorcist. and sed gerbs, spells and rituals to cure the sick. Because of the knowledge of sorcery Kurumba were greatly feared. When bad things happened they were often blamed. In eh 1800s there were several massacres of Kurumbas in relationship for perceived acts of sorcery. Kurumbas are not employed as much as sorcerers as they were in the past."

    While that site does actually mention the Todas in passing, it has no description of them. This, somewhat special relationship between the three tribes, originates from the Ramayana war with Lanka (probably the first and oldest war known to anyone). Some of B. P. Wadia's story has been obtained from Dallas Tenbroek, a friend who lived with him in the area and witnessed him meet a Toda one time, who then wandered off into the jungle instead of down the road.

    You can get "official" information that perhaps vaguely resembles this, but we've just said: the first recorded war is essentially still ongoing, and some people take it so seriously that they would rather hide in the woods than prove it to you.

    Edit: after posting about the Todas, making reference to a couple of paragraphs in Isis Unveiled, some caveats. Isis was done around 1877 and in retrospect, HPB was not all that satisfied with it. Words went missing from the manuscript; originally titled The Veil of Isis, they had to change it because there was already a book by that name; nevertheless, the original title got stamped on a lot of the headers. It was not really intended for the general public, it was aimed at persons newly interested in Theosophy, which in 1875 was launched mostly as a rebuff to the Spiritualism (necromancy) that was a fad in America at that time.

    Later--in 1883, a year after meeting Narayan around Arcot, she took an adventure for three months to Ooty and came out with a five chapter book, originally in French, now translated as The Peoples of the Blue Mountains (Nila, blue, giri, hills). She stayed in the household of General Henry Rhodes Morgan, a Theosophist, who was basically the first/oldest English family in the area (since 1845). It's pretty amazing.

    From this, we find that the Todas do not even have words for lie, steal, god, religion; nothing distinguishes female, infant girl, grown woman--they are all called mother. The Todas say that the cairnstones and large graves on the mountaintops were there when they got there. They do not have an elaborate philosophy, they know nothing of science or all possible occult powers, what they are is healers. They say this is done by love from the sun. They will not heal drunks or wicked people, which the buffalo makes the decision on that.

    She said "mulla" refers more to a thorn bush and the Mulla Kurumbas mostly live in thickets. These Kurumbas are very, very nasty; the only exception to this is when a Toda approaches. The Toda does not have to touch them, or even do anything, if he gets close, they simply go into a seizure.

    Those five chapters are well worth investigating, her prose is really great fun, and she was able to squeeze a lot of juice before the area got too "civilized". Slightly different on some details, but way better than two paragraphs in Isis.

    The People of the Blue Mountains
    Last edited by shaberon; 17th September 2018 at 05:24.

  20. The Following 3 Users Say Thank You to shaberon For This Post:

    DNA (19th January 2017), Flash (17th December 2017), Vernaianawa (5th March 2018)

  21. Link to Post #131
    United States Avalon Member
    Join Date
    1st April 2016
    Posts
    1,494
    Thanks
    2,090
    Thanked 4,783 times in 1,266 posts

    Default Re: The Serpent, the Black Sun, HPB & St. Germain

    John King



    Self-portrait. Drawn from the astral plane. HPB did some of the foliage, but John decided she worked too slowly and finished it.

    Here's one of the main things that have caused many people to conclude that HPB was a fraud, a schizophrenic, or a British agent. In early times, one of her first magic teachers was Paulos Metamon, a Copt who was supposedly well-known around Cairo. It seems to be accepted that Max Theon at one point was another student of his, and that later on, he was an advisor to the Ottoman Khedive Ismail Pasha. By using what I call "couched" language, which abounds with vague phrases like "is linked to", people find proof of the preceeding allegations through these points. Hermetic Brotherhood of Luxor, again, is its own thing, distinct from the Brotherhood of Luxor, and HPB repudiated it.

    John King was the equivalent of a celebrity of the dead, and had been used by mediums for years, as the ghost of a British pirate. Col. Olcott, who had been investigating Spiritualism for years, met HPB when she was sent to counter it, and quickly realized that what she was doing was very different than what mediums of the dead were doing.

    Her John King was a mix of elementals and the astral projection of a living person. Elementals were used to cause knocks or raps in answer to questions. One time Olcott challenged her, and went through a series of questions which kept being answered correctly. Finally, it was "How many keys are on my ring (which was in his pocket)?". Again-correct. Olcott himself didn't know how many there were. HPB explained it and said it was easy--even though you don't "know" how many, the memory is there in your subconscious, and all I do is read that and tell him how many. To her, that was nothing.

    So, appropriating the name John King was simply a way to get the foot in the door, so to speak. The Adepts freely admit that--towards probationers--they are deceptive and manipulative. This can be seen in the early letters to Olcott from the Luxor branch. They were using HPB's second marriage to Mr. Bettanelly as a trial, with Olcott as the "hinge". He was to prevent her from returning to Philadelphia without ever giving the real reasons. In doing so, he was watched at one time by the heads of the Ellora, Solomon, and Zoroaster sections (Ellora actually being the fifth section). One night he was watched by no less than seven adepts. HPB was being raised in Ellora; she had said her initiation was with the Druze (of Lebanon).

    John's behavior could often be classified as irritating or nonsensical. He was around almost every night in those days and was pretty nosy and manipulative about money. He helped HPB through a lawsuit by recommending the opposite of her lawyer's counsel, and, at the end, made him beat up the other lawyer. So to appearances sake, he was rather unconventional to say the least. But we try to penetrate beyond appearances.

    Nevertheless, HPB described him as an initiate, but less than a master. There are some other reasons, but, considering Hilarion Smerdis went to Tibet for that higher initiation in 1886, that's most likely who it actually was. He wrote some fictional stories with HPB and two with Mabel Collins. She had known Hilarion and/or John since at least as early as 1860.

    The early Luxor communications have a distinctively Rosicrucian tone. By this, we do not mean that it was launched by Akhenaton, that they were Lutherans, or formed any public society of that name. In the portrait, we are asked to learn the meaning of the symbols; including the mother/child, the book (which I can make out Alpha-Omega and a Hebrew Shin), the hexagram and Jaina cross, the columns with symbols on top. Koothoomi was in perfect agreement with the well-known Rosicrucian phrase "To know, to dare, to will, and to keep silence". HPB bequeathed to Annie Besant an "18th degree Rose Croix" pendant which had belonged to Cagliostro. So the "real" Rosicrucians were secret as in dead silent. They had at least five branches in multiple mid-Eastern and European countries, although we cannot attach even a pseudonym to most of the members. Nevertheless, we can see that an "advanced chela" has the ability to project anywhere in the world, and not merely observe, but to carry out actions.

    Thus, "some of our chelas would seem to you like adepts; you couldn't tell the difference". The Brotherhood's plan is to affect public consciousness by slow degrees, which is represented by infiltrating Spiritualism, then starting a small focused society, before issuing a fragment of their secrets to the world wide public, as a direct opposition to materialistic science and a variety of religious dogma.

    Also, Philadelphia was where she hurt her leg moving a bed. It swelled to twice normal size and turned black. She started having 2-3 hour sessions where observers could not detect a pulse and thought she was dead. The doctor wanted to amputate it. She refused. John King healed her by having her keep a little white dog on it. And then suddenly overnight she was normal.

    The house where this happened is now the White Dog Cafe on Sansom Street.

    Last edited by shaberon; 8th January 2017 at 11:24.

  22. The Following 4 Users Say Thank You to shaberon For This Post:

    DNA (19th January 2017), Flash (17th December 2017), Vernaianawa (5th March 2018), Zampano (12th January 2017)

  23. Link to Post #132
    United States Avalon Member
    Join Date
    1st April 2016
    Posts
    1,494
    Thanks
    2,090
    Thanked 4,783 times in 1,266 posts

    Default Re: The Serpent, the Black Sun, HPB & St. Germain

    Auric Egg

    Here's something I never got the first time around. During my days of untrained clairvoyance, I saw...countless ones of these, mostly around people, and being an egg almost literally, usually a luminous golden yellow. And I just took that as, ok, that's an aura. One time I saw one that was white and filled with hundreds of undulating serpentine patterns and that made me go "huh?" all day.

    From reading general information, you get a sense of the aura as an expression of health, quality, thoughtforms, and things like that.

    Occultism has it the other way around. The auric egg emerges from the monad, encompasses all the planes, and more or less "is" the actual person. Before incarnations, on the astral plane, the egg will put out its own kind of umbilical cord which creates the astral double, over which the physical person grows. So its less...you have an astral body which gives off an aura...but you have an aura that gives off a body. Of course, there's interplay; the general method is "from within outwards, then back within", but this doesn't mean expanding and contracting in space, so much as moving from subjective to objective and back.

    In Kama loka, one does not even have a body double per se. The kama manas is merely a bundle of skandhas, of psychological "parts". This is why nothing is called kama sharira, as in "linga sharira", which is the same body throughout one's life, can only do limited projections, and hangs around graves until the flesh is gone.

    Kama manas can temporarily be given a double in two cases. One case is "higher" astral projection that can go anywhere. When this is done consciously by an adept, the egg produces Augoeides, "mayavi rupa" or illusionary body. And so for example, this is why it disappears when they get done using it; it's not a real body that has to go home, it can simply be turned off.

    The other case is after death. The auric egg will carry the soul into Deva-chan, dropping out a residue of their memories into kama loka, which then galvanizes the skandhas into an image of the person--kama rupa, or the Spook. This lasts for longer or shorter periods of time, depending on how dominant the skandhas were during earthly life.

    Being the permanent person across any and all planes, the egg is the retainer of karmic records, so it may be called a Karmic body. The same kind of egg is the Hiranyagarbha of Brahma, and it is seen with many other deities, as the constitution is similar on every scale. Often used as a symbol of eternity of the cosmos. It becomes the container of, seed of, and keeper of the results of, all the incarnations that happen inside of it, whether with respect to a person or a planetary chain.

    By learning how to control their faculties, a clairvoyant can study the auric egg and understand everything about a person, notwithstanding the appearances or fronts which may be consciously displayed.

    Because the spiritual planes are called "arupa", "without form", it would seem they have no body image of a person at all, but only an egg; maybe with some kind of "stuff" inside it. The one I saw with so many finely detailed fast moving parts must have been an aspect of prana or the "middle" astral plane.

    In several senses the egg could be considered the highest, most sacred principle of a person and also the "sutratma" or thread to atma, as the atma is not really in a person nor a principle of consciousness.

  24. The Following 3 Users Say Thank You to shaberon For This Post:

    DNA (19th January 2017), Shannon (18th January 2017), Vernaianawa (5th March 2018)

  25. Link to Post #133
    Turkey Avalon Member
    Join Date
    29th January 2011
    Location
    Planet Earth. Possibly for too long.
    Age
    42
    Posts
    197
    Thanks
    207
    Thanked 1,073 times in 179 posts

    Default Re: The Serpent, the Black Sun, HPB & St. Germain

    Shaberon,

    Thanks for this excellent thread and the info you've been sharing. This helps me a lot to connect more dots.

    Wouldn't want to derail the flow - but I have a question. Are you familiar with Nicolas Roerich, his Tibet expeditions and "cosmic rays" he had been writing about? Cant find too much reliable info on these unfortunately.

  26. The Following 5 Users Say Thank You to Feritciva For This Post:

    DNA (19th January 2017), pueblo (19th January 2017), shaberon (13th January 2017), Shannon (18th January 2017), Vernaianawa (5th March 2018)

  27. Link to Post #134
    United States Avalon Member
    Join Date
    1st April 2016
    Posts
    1,494
    Thanks
    2,090
    Thanked 4,783 times in 1,266 posts

    Default Re: The Serpent, the Black Sun, HPB & St. Germain

    Hi--yes. Nicolas was the husband of Helena Roerich, who at one point began claiming to receive messages from Morya, which is another one of those things that's extremely questionable. The tone of those books bears almost no resemblance to anything he was ever known to have contributed by people who knew him personally. If Morya had any interest in meeting the Roerichs, it would have happened. However, by the 30s, Tibetan peasants were saying that the Mahatmas were not really seen in their country any more (apparently, they prepared for the Chinese occupation well in advance).

    Nicolas Roerich was utterly fascinated by the Shamballa legend, Eurasian unity with Russia as the "white knight" and had a hand in knocking together the first Buddhist temple in Europe/Russia in the 30s. For his expedition, he eventually wound up with the backing of Americans in the Franklin Roosevelt administration. Given the nature of those backers, it's been seen as a tie to United Nations/One World Government types of maneuvering. He also was a bit too close to "the messiah is coming" which does not appear to be spiritually accurate, a healthy psychological attitude, or something that would lead you to question One World Government.

    Some of his artwork was pretty good. Although I did read some of his wife's books, I am not familiar with his writing. As with anything else, it can be agreed upon, to the extent that it is true.

    If what you were thinking of is not uploaded here, I am not sure: http://www.roerich.org/roerich-writings.php

    We can certainly look at those five books and, if anything seems amiss, sometimes that's just what happens because people are untrained (such as Swedenborg), and in some cases people obviously knew better but decided to change things for some ulterior motive. "Cosmic rays" could mean any thing from the one ray, to the seven primordial rays, through infinite subdivisions and combinations including all the radiation in the physical plane. So I don't know how he intended that particular term, but likely its in there. A lot of it is poetry, and some of that can give one a good inspirational feeling.

  28. The Following 3 Users Say Thank You to shaberon For This Post:

    DNA (19th January 2017), Vernaianawa (5th March 2018), Zampano (19th January 2017)

  29. Link to Post #135
    United States Avalon Retired Member
    Join Date
    8th May 2011
    Location
    Arizona
    Age
    47
    Posts
    3,931
    Thanks
    27,040
    Thanked 20,800 times in 3,643 posts

    Default Re: The Serpent, the Black Sun, HPB & St. Germain

    Quote Posted by shaberon (here)
    That's about it for now; maybe a few more things later. Welcome any comments or rebuttals. Just trying to concentrate these ideas instead of remaining strewn across lots of threads.

    Hi Shaberon


    When most folks start a Blavatsky type thread it is usually to bash her. I've always been perplexed to no end as to why this is.
    Personally I'm a huge Blavatsky fan, I've read ISIS Unveiled as well as The Secret Doctrine, and I found both works extremely interesting.
    I was introduced to Blavatsky due to my love for H.P. Lovecraft. You can find story germs for Lovecraft in the works of Blavatsky and her co-hort the linguist and master of ancient languages Eliphas Levi.
    I would also like to throw it out there that Edgar Cayce was sometimes criticized because his creation mythos was basically an exact match for Madame Blavatsky's creation mythos. Rather than state a case of plagerism had occurred, I myself find that the truth "will out" and that these folks compliment one another in their creation mythos as having been stated so similarly.

  30. The Following 5 Users Say Thank You to DNA For This Post:

    Eram (19th January 2017), shaberon (14th January 2017), Shannon (18th January 2017), Vernaianawa (5th March 2018), Zampano (19th January 2017)

  31. Link to Post #136
    United States Avalon Member
    Join Date
    1st April 2016
    Posts
    1,494
    Thanks
    2,090
    Thanked 4,783 times in 1,266 posts

    Default Re: The Serpent, the Black Sun, HPB & St. Germain

    Well she was a huge threat to the church and to materialistic science, after threatening spiritualism--no concealing that intention. The Catholics even bribed her something like 25,000 Francs (a pretty penny in those days) to never mention Christ again; but of course, she blew them off.

    And in a more modern sense, I started finding articles all over the net about how Bailey and others of that ilk were her "followers" or that she had made some kind of juggernaut institution that people were perpetuating in the World Government scheme. As much as that may be true in their cases, HPB had nothing to do with that. The British police shadowed her in India for eight months and came away with nothing.

    Lovecraft definitely hinted at The Secret Doctrine and several obscure old grimoires like De Mysteriis Vermis, which made people believe his Necronomicon was a real one, and the more he denied it, the more they believed...in terms of fiction, I like a lot of the old stuff from Blackwood and Bierce up through Lovecraft and some of the "Weird Tales" gang. Creating fiction is fine, until reaching the point of religious and political platforms made of it. At almost any point in history, we find the same Cosmogenesis, which sooner or later gets buried and distorted by some kind of church.

  32. The Following 5 Users Say Thank You to shaberon For This Post:

    DNA (15th January 2017), Flash (20th January 2017), Shannon (18th January 2017), Vernaianawa (5th March 2018), Zampano (19th January 2017)

  33. Link to Post #137
    United States Avalon Member
    Join Date
    1st April 2016
    Posts
    1,494
    Thanks
    2,090
    Thanked 4,783 times in 1,266 posts

    Default Re: The Serpent, the Black Sun, HPB & St. Germain

    Akashic Records

    This would be John King's book in the picture above--just not by that name. That phrase does not come from the original teachings, which consistently used the term astral light and impressions in the astral light.

    Hebrew letter Shin represents the element Fire, and also astral light. Eliphas Levi basically copied it to stick on the head of his Baphomet, which has a central lamp between the two horns or opposite poles. Alpha-Omega is a Greek form for astral light, being, with respect to the physical world, the basis of everything beginning to end. "Book of Life" is another esoteric phrase for the series of impressions.

    Akasha on the other hand is purity in the highest planes. As it steps down and reflects, it does eventually become astral light, and in this manner, HPB occasionally used it with a lower-case a, in phrases like "akasha or astral light". Usually when referring to its own plane, it was capitalized. So there was generally a clear indication whether the primordial virgin was meant, or a lower degree of it in a fecund state. By repeating the phrase "Akashic records", it tends to convey the idea that it exists physically and has no other purpose than to act as a video recorder, whereas, even in ancient exoteric Vedism, Akasha is held to be quite sacred, and seen from that viewpoint much more than from that of its lowest dregs.

    But clairvoyantly, yes, it receives every tiny little detail and every thoughtform so...garbage in = garbage out. That could make it fairly intimidating in the lower worlds.

  34. The Following 2 Users Say Thank You to shaberon For This Post:

    DNA (19th January 2017), Vernaianawa (5th March 2018)

  35. Link to Post #138
    United States Avalon Member
    Join Date
    1st April 2016
    Posts
    1,494
    Thanks
    2,090
    Thanked 4,783 times in 1,266 posts

    Default Re: The Serpent, the Black Sun, HPB & St. Germain

    Alice Cleather



    Here's someone who kind of disappears into the legions of authors and was never particularly famous. But she basically only ever wrote about two things: her friendship with HPB and how pseudo-Theosophy started. I've probably beat up this topic enough and will leave her as kind of the "go-to" person because she was there when it all went down.

    She was English and entered HPB's Esoteric Section there around 1888. In 1920, she was in the first group of Europeans to take vows at Bodh Gaya with Geshe Rinpoche at the Donkar monastery, Chumbi Valley. In 1925, she met the Teshu Lama in Peking and together they re-released "The Voice of the Silence", surgically removing all of Ms. Besant's alterations.

    Ms. Besant was the head of the Adyar section, as W. Q. Judge was head of the American section when HPB passed away in 1891. Judge was very intelligent, but he was not a powerful person, and fell under the influence of Katherine Tingley, a medium and channeler with a pro-Western bias who wanted to establish a revival of the mysteries. This was at the same time as severing relations with Adyar, where, similarly, Annie Besant was taken under the influence of C. W. Ledbeater of the Liberal Catholic Church. Due to his improper activities, Col. Olcott pressured him to resign in 1906, but when Olcott died the following year, Besant re-instated him as the quintessential guru. After Judge passed away, Ms. Tingley was then the head of the American section.

    One of the strange things that Alice Cleather said Tingley told her, was that Judge is Koothoomi.

    Cleather soon resigned because she saw both the Besant and Tingley societies departing fast and far from the HPB original. She was joined by many others, including Mr. Martyn, head of the Australian branch, and the well-known G. R. S. Mead, for the same reason.

    She was also a musician and established the Blavatsky Association. Her book exposing the intrigues and deviations runs for about a hundred pages and is available in pdf here: http://www.theosophyonline.com/ler.php?id=3839

    Naturally and predictably, she took a swipe at Alice Bailey in a much shorter pamphlet: https://blavatskytheosophy.com/the-p...-alice-bailey/

  36. The Following 8 Users Say Thank You to shaberon For This Post:

    DNA (19th January 2017), drneglector (23rd January 2017), Eram (19th January 2017), Feritciva (19th January 2017), Flash (17th December 2017), Peter UK (10th November 2019), Vernaianawa (5th March 2018), Zampano (19th January 2017)

  37. Link to Post #139
    Netherlands Avalon Member Eram's Avatar
    Join Date
    19th March 2012
    Age
    46
    Posts
    1,478
    Thanks
    65,641
    Thanked 10,991 times in 1,435 posts

    Default Re: The Serpent, the Black Sun, HPB & St. Germain

    Quote Posted by DNA (here)
    Hi Shaberon


    When most folks start a Blavatsky type thread it is usually to bash her. I've always been perplexed to no end as to why this is.
    According to Laurency (An esoteric writer), the constant bashing of Blavatsky is mostly inspired by the "Black Lodge". A name Laurency attributed to the Dark Magicians who reside in the Astral/emotional world and who gave up their soul (soul is not a correct word for it, but it will have to do for now) in order to relish themselves in their love and exercise of power.

    Blavatsky is supposed to be the first to have openly laid out the knowledge of reality since the times of Atlantis and the Black Lodge above everything else do not want humanity in possession of this knowledge, for it would immediately end the power that these black magicians have over us.

    How the Black Lodge can make people work and write on their behalf is another story, which would make this post too long, so I will not go there now.
    hylozoic tenet: “Consciousness sleeps in the stone, dreams in the plant, awakens in the animal, and becomes self-conscious in man.”

  38. The Following 8 Users Say Thank You to Eram For This Post:

    DNA (19th January 2017), drneglector (23rd January 2017), Flash (20th January 2017), pueblo (19th January 2017), shaberon (20th January 2017), Vernaianawa (5th March 2018), wavydome (12th June 2018), Zampano (19th January 2017)

  39. Link to Post #140
    United States Avalon Retired Member
    Join Date
    8th May 2011
    Location
    Arizona
    Age
    47
    Posts
    3,931
    Thanks
    27,040
    Thanked 20,800 times in 3,643 posts

    Default Re: The Serpent, the Black Sun, HPB & St. Germain

    Quote Posted by shaberon (here)
    Akashic Records
    This would be John King's book in the picture above--just not by that name. That phrase does not come from the original teachings, which consistently used the term astral light and impressions in the astral light.
    Astral light is definitely a real thing as far as I'm concerned. I have a thread on How To See A Ghost For Yourself , and in this thread I discuss incidents where I've helped them pass over, in such instants, in those final instants anyway when the tunnel appears, tunnel/portal both would be correct, the room is flooded with pinkish astral light. I've always been surprised that the light wasn't white but there you have it. This astral light has always seemed to coincide with a sense of being reinvigored, or spiritual replenishment. My method for helping a ghost pass over involves an initial reiki session which is energetically taxing, if I fail in helping the ghost to the other side I do not receive the benefit of being replenished, but if I succeed, my energy levels fire right back up to full saturation. I've often wondered if the pinkish astral light is the source of my replenishment as I can't say 100% for sure.
    Quote Posted by shaberon (here)
    Hebrew letter Shin represents the element Fire, and also astral light. Eliphas Levi basically copied it to stick on the head of his Baphomet, which has a central lamp between the two horns or opposite poles.
    The representation of fire and astral light make sense for the Baphomet, being as the entire depiction represents a gateway.
    The Baphomet is present during so many dark/satanic/saturnistic rituals because it is in my opinion that these practitioners are attempting to open a gateway such as I've described in what happens when I'm helping a ghost pass over. Furthermore this is often why human sacrifice is associated with such rituals being as this is the easiest way to insure that a portal is opened.
    Quote Posted by Eram (here)
    According to Laurency (An esoteric writer), the constant bashing of Blavatsky is mostly inspired by the "Black Lodge". A name Laurency attributed to the Dark Magicians who reside in the Astral/emotional world and who gave up their soul (soul is not a correct word for it, but it will have to do for now) in order to relish themselves in their love and exercise of power.
    This makes sense. I have a thread called My Interactions With A Shadow Being. My supposition was that shadow beings represent a pyramid scheme in terms of human energy theft. My conclusians were that Shadow beings were once ghosts, but they had been tricked into joining a system that relied on taking energy from living conscious physical beings. The lowest on the rungs of this pyramid scheme were those who were attached to human beings and mostly in a sexual manner. Sex being the greatest energetic practice we humans undertake. These shadow beings would attach themselves to the base chalkra, and they would attach themselves to several though I know not how many beings. Then in turn there were shadow beings above them who would draw power away from them through intimidation. This would go on until you reached the top where you would have a dark god or arch-parasite. I have a thread called Parasitic gods where I explain what this arch-parasite would be like.

    Quote Posted by Eram (here)
    Blavatsky is supposed to be the first to have openly laid out the knowledge of reality since the times of Atlantis and the Black Lodge above everything else do not want humanity in possession of this knowledge, for it would immediately end the power that these black magicians have over us.

    How the Black Lodge can make people work and write on their behalf is another story, which would make this post too long, so I will not go there now.
    This makes sense.

  40. The Following 7 Users Say Thank You to DNA For This Post:

    drneglector (23rd January 2017), Eram (19th January 2017), Flash (20th January 2017), shaberon (20th January 2017), Vernaianawa (5th March 2018), YoYoYo (22nd January 2017), Zampano (19th January 2017)

+ Reply to Thread
Page 7 of 23 FirstFirst 1 7 17 23 LastLast

Posting Permissions

  • You may not post new threads
  • You may not post replies
  • You may not post attachments
  • You may not edit your posts