View Full Version : Graphene in the 'vaccines'
Gwin Ru
30th June 2021, 17:49
...
... Big badaboom!
No mNRA (Gene Therapy) in Pfizer "Vaccine" (https://henrymakow.com/2021/06/no-biological-content-in-pfize.html)
by Des Marxants
(henrymakow.com) June 30, 2021
https://henrymakow.com/upload_images/mnra-no.JPG
(l. Pfizer vaccine; r. Graphene)
Spanish researchers put the Pfizer vaccine under an electron microscope and found it contains 99% graphene oxide and hardly anything else.
There is practically NO evidence that this "vaccine" is gene therapy. There is ZERO genetic material: Messenger RNA or DNA or spike protein. It means this "vaccine" has nothing to do with a so-called virus. This product wasn't developed to avoid an infection caused by a virus. The true purpose of this product remains hidden. No official statement from governments or health institutions has been made. The toxicity of graphene oxide (https://particleandfibretoxicology.biomedcentral.com/articles/10.1186/s12989-016-0168-y) is reason enough to stop the global vaccination program.
Makow - If this is true, it would discredit a lot of MDs who are saying it is gene altering (https://stateofthenation.co/?p=63490). Could that be the purpose?
by Des Marxants
(henrymakow.com)
The whole world is following the story released on the Spanish web site program la Quinta Columna. (https://odysee.com/@laquintacolumna:8/CONTENIDODELAVACUNASEG%C3%9ANINFORMEPRELIMINARUNIVERSIDADDEALMER%C3%8DA:1?r=8qjPwG8VB8Z9EGGQPLU4DVo5 hYpAPjde)
A June 28th (https://odysee.com/@laquintacolumna:8/CONTENIDODELAVACUNASEG%C3%9ANINFORMEPRELIMINARUNIVERSIDADDEALMER%C3%8DA:1?r=8qjPwG8VB8Z9EGGQPLU4DVo5 hYpAPjde) report from the University of Almeria (in Spain) (https://www.ual.es/universidad/serviciosgenerales/stecnicos/microscopia/microscopia-electronica-de-transmision) supports the findings of the two researchers hosting the daily broadcast.
Surprising conclusions on the first results of the microscopy on one covid-19 mRNA Comirnaty (Pfizer) sample. (https://www.docdroid.net/rNgtxyh/microscopia-de-vial-corminaty-dr-campra-firma-e-1-fusionado-pdf)
Suspicions of the two researchers turned out true. There is almost NO Biological matter in the Pfizer covid-19 vial. What the lab in the University of Almeria found has nothing to do with mRNA. The main matter found was a substance more alike to nanoparticles of graphene or a very similar nanomaterial. Extraction and quantification of mRNA in the sample, identified that 99% of the whole substance inside the vial was highly probable graphene oxide or something very similar, just very few genetic material was found.
Until now, no lipid nanocapsules were identified
The study mentions that there is a reduced form of graphene oxide (GO) when graphene oxide is mixed with hydrogen it becomes MAGNETIC (MGO) (https://www.sciencedirect.com/science/article/abs/pii/S1386947714002604) it is also known as reduced graphene oxide (https://nanografi.com/blog/what-is-the-difference-between-graphene-oxide-and-reduced-graphene-oxide/) (this happens when it is injected blood too)
Graphene oxide layers (https://www.researchgate.net/figure/Scanning-electron-microscopy-image-of-a-reduced-graphene-oxide-layer-dark-area_fig5_326001062) from scientific literature and from a commercial graphene oxide sample compared against the microscopy performed on the Pfizer sample show identical patterns in both electron and optical microscopy, letting no gap to doubts we talk about the same material.
The study offers solid evidence of possible graphene derivatives because the structure seen in the microscopy is characteristic. Academics who previously worked with graphene oxide were consulted and agreed there is no doubt about the presence of graphene oxide in the vial.
The study was required by Biostatistician Ricardo Delgado and contrasts a graphene oxide sample bought in the market against covid-19 Pfizer mRNA Comirnaty. This preliminary study includes optical and electron microscopy conducted by Prof. Dr. Pablo Campra team director in charge. Digital signature here. (https://verificarfirma.ual.es/verifirma/pages/verification-code.htm#secondSection)
It has been only one brand jab but more tests are needed to be done with other vials. More studies are to come with some other different techniques. La Quinta Columna (https://www.laquintacolumna.net/)makes a call to other institutes and universities to join this research crusade for the truth.
--
Related:
Covid Vaccine Delivers Nanoparticles for Mind Control (https://www.henrymakow.com/2021/06/covid-vaccine-delivers-nanoparticles.html?_ga=2.54320362.319600760.1622905010-903648786.1588285733)
A French company is already ready to market 5 G / Covid vaccine packages for "augmented human beings" having received nanoparticles allowing Human-Machine fusion. https://www.numsquare.fr/choisir-son-forfait-5g-avec-son-vaccin-contre-le-covid-coronavirus/
among the partners of this society - at the bottom of the page - there is the Thinktank "Next Humanity" which has already defined what will be our future as augmented beings. https://nxu-thinktank.com/un-monde-de-centaures-une-intelligence-artificielle-pour-des-travailleurs-augmentes-version-enrichie/
https://nxu-thinktank.com/wp-content/uploads/2017/05/La.r%C3%A9volution.NBIC_.pdf
Gwin Ru
4th July 2021, 11:55
...
... more about graphene: Graphene Oxide dangers and 5G (https://www.unitednetwork.news/content/detail/60de26e766d5ff00197cd848/Graphene-Oxide-Michelle-Mountain) 05:43
Graphene Oxide - Michelle Mountain
This is a very interesting video if you think in terms of graphene, which is a two-dimensional carbon allotrope. It is composed of carbon atoms positioned in a hexagonal design, which can be said to resemble a chicken wire or a bee hive or wasps nest.The video is the opening ceremony for "The Circle of Light" festival in Moscow in September. The symbology is of course subject to interpretation but it is worth a look under the current situation we are experiencing.
ZOfuqCX-ZD4
Gwin Ru
6th July 2021, 17:04
...
... incredible amount of graphene content... what the hell are they doing???
BREAKING DISCOVERY! The ACTUAL CONTENTS Inside Pfizer Vials EXPOSED! (https://rumble.com/vjgmj9-breaking-discovery-the-actual-contents-inside-pfizer-vials-exposed.html) 15:37
Stew Peters Show (https://rumble.com/c/StewPeters)
Published July 5, 2021 97,097 Views
Rumble (https://rumble.com/) — Scientists have examined the Pfizer 'vaccine', and what they found was HORRIFIC...It's Poison!
www.StewPeters.tv (http://www.StewPeters.tv) | www.DrJaneRuby.com (http://www.DrJaneRuby.com)
vgugdz
chrifri
7th July 2021, 01:20
...
... Big badaboom!
No mNRA (Gene Therapy) in Pfizer "Vaccine" (https://henrymakow.com/2021/06/no-biological-content-in-pfize.html)
by Des Marxants
(henrymakow.com) June 30, 2021
https://henrymakow.com/upload_images/mnra-no.JPG
(l. Pfizer vaccine; r. Graphene)
Spanish researchers put the Pfizer vaccine under an electron microscope and found it contains 99% graphene oxide and hardly anything else.
There is practically NO evidence that this "vaccine" is gene therapy. There is ZERO genetic material: Messenger RNA or DNA or spike protein. It means this "vaccine" has nothing to do with a so-called virus. This product wasn't developed to avoid an infection caused by a virus. The true purpose of this product remains hidden. No official statement from governments or health institutions has been made. The toxicity of graphene oxide (https://particleandfibretoxicology.biomedcentral.com/articles/10.1186/s12989-016-0168-y) is reason enough to stop the global vaccination program.
Makow - If this is true, it would discredit a lot of MDs who are saying it is gene altering (https://stateofthenation.co/?p=63490). Could that be the purpose?
by Des Marxants
(henrymakow.com)
The whole world is following the story released on the Spanish web site program la Quinta Columna. (https://odysee.com/@laquintacolumna:8/CONTENIDODELAVACUNASEG%C3%9ANINFORMEPRELIMINARUNIVERSIDADDEALMER%C3%8DA:1?r=8qjPwG8VB8Z9EGGQPLU4DVo5 hYpAPjde)
A June 28th (https://odysee.com/@laquintacolumna:8/CONTENIDODELAVACUNASEG%C3%9ANINFORMEPRELIMINARUNIVERSIDADDEALMER%C3%8DA:1?r=8qjPwG8VB8Z9EGGQPLU4DVo5 hYpAPjde) report from the University of Almeria (in Spain) (https://www.ual.es/universidad/serviciosgenerales/stecnicos/microscopia/microscopia-electronica-de-transmision) supports the findings of the two researchers hosting the daily broadcast.
Surprising conclusions on the first results of the microscopy on one covid-19 mRNA Comirnaty (Pfizer) sample. (https://www.docdroid.net/rNgtxyh/microscopia-de-vial-corminaty-dr-campra-firma-e-1-fusionado-pdf)
Suspicions of the two researchers turned out true. There is almost NO Biological matter in the Pfizer covid-19 vial. What the lab in the University of Almeria found has nothing to do with mRNA. The main matter found was a substance more alike to nanoparticles of graphene or a very similar nanomaterial. Extraction and quantification of mRNA in the sample, identified that 99% of the whole substance inside the vial was highly probable graphene oxide or something very similar, just very few genetic material was found.
Until now, no lipid nanocapsules were identified
The study mentions that there is a reduced form of graphene oxide (GO) when graphene oxide is mixed with hydrogen it becomes MAGNETIC (MGO) (https://www.sciencedirect.com/science/article/abs/pii/S1386947714002604) it is also known as reduced graphene oxide (https://nanografi.com/blog/what-is-the-difference-between-graphene-oxide-and-reduced-graphene-oxide/) (this happens when it is injected blood too)
Graphene oxide layers (https://www.researchgate.net/figure/Scanning-electron-microscopy-image-of-a-reduced-graphene-oxide-layer-dark-area_fig5_326001062) from scientific literature and from a commercial graphene oxide sample compared against the microscopy performed on the Pfizer sample show identical patterns in both electron and optical microscopy, letting no gap to doubts we talk about the same material.
The study offers solid evidence of possible graphene derivatives because the structure seen in the microscopy is characteristic. Academics who previously worked with graphene oxide were consulted and agreed there is no doubt about the presence of graphene oxide in the vial.
The study was required by Biostatistician Ricardo Delgado and contrasts a graphene oxide sample bought in the market against covid-19 Pfizer mRNA Comirnaty. This preliminary study includes optical and electron microscopy conducted by Prof. Dr. Pablo Campra team director in charge. Digital signature here. (https://verificarfirma.ual.es/verifirma/pages/verification-code.htm#secondSection)
It has been only one brand jab but more tests are needed to be done with other vials. More studies are to come with some other different techniques. La Quinta Columna (https://www.laquintacolumna.net/)makes a call to other institutes and universities to join this research crusade for the truth.
--
Related:
Covid Vaccine Delivers Nanoparticles for Mind Control (https://www.henrymakow.com/2021/06/covid-vaccine-delivers-nanoparticles.html?_ga=2.54320362.319600760.1622905010-903648786.1588285733)
A French company is already ready to market 5 G / Covid vaccine packages for "augmented human beings" having received nanoparticles allowing Human-Machine fusion. https://www.numsquare.fr/choisir-son-forfait-5g-avec-son-vaccin-contre-le-covid-coronavirus/
among the partners of this society - at the bottom of the page - there is the Thinktank "Next Humanity" which has already defined what will be our future as augmented beings. https://nxu-thinktank.com/un-monde-de-centaures-une-intelligence-artificielle-pour-des-travailleurs-augmentes-version-enrichie/
https://nxu-thinktank.com/wp-content/uploads/2017/05/La.r%C3%A9volution.NBIC_.pdf
After having seen the video posted above (post 187) with Dr. Ruby claiming that she has practically almost 100% proof that GO is the only ingredient in the Pfizer jab, I decided to check the source she bases her claims on. Why? Because I believe that Dr. Ruby is not a serious researcher and just trying to be in the spotlight with claims of information which definitely is not always true. One example? The claim that Airlines are telling their vaxxxed clients not to fly. So far there is still no proof of that.
To find out if Dr. Ruby's source is trustworthy and trying to find out a bit more about GO I checked first this thread and saw this post. As this post is using the same source I decided to post my comments regarding the source here. The source, as mentioned is a study from Spain posted on the webage of www.laquintacolumna.net.
Now to the paper and the information above according to Henry Makow
1. I was not able to find in the paper anythings that says that the jab contains 99% GO and hardly anything else.
2. The paper does not state anywhere that there is practically NO evidence that this 'vaccine" is gene therapy, that there is ZERO genetic material: Messenger RNA or DNA etc Neither does the paper state that the vaccine has nothing to do with a so-called virus etc as per first paragraph above.
3. The statement that the university of Almeria is supporting the findings is definitely NOT true. On page 23, which is a disclaimer, it says clearly "Los resultados y conclusiones de este informe no implican posición institucional alguna de la Universidad de Almeria". This means that the university does not take any position nor responsibility for this paper. So how can Makow or Marxants claim that the university is supporting the findings if the disclaimer does not confirm such support?
4. On page 22 of the paper, it says the following; El estudio microscopico de la muestra aporta sólidas evidencias de presencia probable de derivados de grafeno, si bien la microscopia no proporciona una prueba concluyente. Although this sentence indicates that there is solid evidence of presence of possible derivatives of GO, there is no indication at all that it is a fact and as mentioned above, there is no mentioning of 99% GO or similar material. Furthermore the second part of the sentence is clear in saying, that the test does not provide any conclusive evidence. With this information on page 22, I cannot understand how Makow/Marxants can claim "Suspicious of the two researchers turned out true. There is almost NO Biological matter in the Pfizer Covid-19 vial. What the lab in the university of Almeria found ........
5. Makow/Marxants claim; "Until now, no lipid nanocapsules were identified. That might be. However I was not able to find any comment on such a fact in the paper
6. Makow/Marxants as well claim; "Graphene oxide layers from scientific literature and from a commercial gaphene oxide sample compared against the microscopy performed on the Pfizer sample show identical patterns in both electron and optical microscopy, letting no gap to doubts we talk about the same material. Well, again, these claims are not correct. In the paper, on page 13, it says "Las mágenes TEM de la muestra RD1 en general presentan una elevada semejanza con mágenes de OG de literatura obtenidas ......" Una elevada semejanza does not mean Identical. It means that it shows a high resemblance. So, unfortunately there is some gap to doubts.
7. On page 14 of the paper it says; Para una identificación definitiva del GO por TEM, es necesario complementar la observación con la caracterización estructural mediante ....... and No ha sido posible por el momento obtener este patrón por la escasez de muestra disponible para su procesamiento, y la disposición caótica y la densidad de los plieges. So, on this page the authors say in order to complete the identification of the Grafene it is necessary to complete the observation with a sample(or samples) with other characteristics, which has not been possible for the moment being due to lack of available samples.
8. as mentioned on page 22 of the paper, the study has been done with only one sample. In order to being able to make a more conclusive study, it is necessary to perform similar tests with lots of samples and furthermore it is important that the following tasks are performed correctly: the proof of origin, traceability and quality control during conservation and transport
With my above remarks, by no means, do I want to claim that GO or the vaxxx is save. GO probably is toxic, although on another paper with the title "Safety Assessment of Graphene-Based Materials: Focus on Human Health and the Environment" (can be found as well on the laquinta webpage): it says "Notably, research conducted in the context of the Graphene Flagship and by other investigators in the past several years has shown that the hazard potential for different members of the GBM family may vary considerably, and it is not a valid statement that all GBMs are as hazardous as carbon nanotubes, nor is it true that all carbon nanotubes are hazardous. https://pubs.acs.org/doi/10.1021/acsnano.8b04758
in any case, if the vaxxx developers would be transparent such studies would not be necessary
Graphene – in the vaccines (https://www.docdroid.net/Ov1M99x/official-interim-report-in-english-university-of-almeria-pdf), graphene in the air, graphen - everywhere!?
When exposed to 5G frequencies: Graphene + 5G = Covid-19 (https://www.orwell.city/2021/07/graphene-oxide-5G-COVID-19.html)
A graphenized human being = remotely controlled bio-chemical robot. How many of them have already been around?! In fact, it could be said that - they have been trying to graphenize everybody, while preventing the truth coming out.
Normal human beings have been moderated and cenzored by the AI in this reality!
***
Graphene – Potential applications (https://www.graphene-info.com/graphene-introduction):
Graphene is an extremely diverse material, and can be combined with other elements (including gases and metals) to produce different materials with various superior properties. Researchers all over the world continue to constantly investigate and patent graphene to learn its various properties and possible applications, which include:
batteries
transistors
computer chips
energy generation
supercapacitors
DNA sequencing
water filters
antennas
touchscreens (for LCD or OLED displays)
solar cells
Spintronics-related products
So, a perfect interface in the human body to be connected to and manipulated by the AI, through 5G network?!
As human beings, we have a natural right to say – NO.
…
chrifri
7th July 2021, 01:47
Graphene – in the vaccines (https://www.docdroid.net/Ov1M99x/official-interim-report-in-english-university-of-almeria-pdf), graphene in the air, graphen - everywhere!?
When exposed to 5G frequencies: Graphene + 5G = Covid-19 (https://www.orwell.city/2021/07/graphene-oxide-5G-COVID-19.html)
A graphenized human being = remotely controlled bio-chemical robot. How many of them have already been around?! In fact, it could be said that - they have been trying to graphenize everybody, while preventing the truth coming out.
Normal human beings have been moderated and cenzored by the AI in this reality!
***
Graphene – Potential applications (https://www.graphene-info.com/graphene-introduction):
Graphene is an extremely diverse material, and can be combined with other elements (including gases and metals) to produce different materials with various superior properties. Researchers all over the world continue to constantly investigate and patent graphene to learn its various properties and possible applications, which include:
batteries
transistors
computer chips
energy generation
supercapacitors
DNA sequencing
water filters
antennas
touchscreens (for LCD or OLED displays)
solar cells
Spintronics-related products
So, a perfect interface in the human body to be connected to and manipulated by the AI, through 5G network?!
As human beings, we have a natural right to say – NO.
…
Graphene in the vaxxx. In the first shot or in the second shot? Just asking. Maybe in the first shot the DNA changing stuff and in the second shot the graphene?
chrifri
7th July 2021, 01:51
Graphene – in the vaccines (https://www.docdroid.net/Ov1M99x/official-interim-report-in-english-university-of-almeria-pdf), graphene in the air, graphen - everywhere!?
When exposed to 5G frequencies: Graphene + 5G = Covid-19 (https://www.orwell.city/2021/07/graphene-oxide-5G-COVID-19.html)
A graphenized human being = remotely controlled bio-chemical robot. How many of them have already been around?! In fact, it could be said that - they have been trying to graphenize everybody, while preventing the truth coming out.
Normal human beings have been moderated and cenzored by the AI in this reality!
***
Graphene – Potential applications (https://www.graphene-info.com/graphene-introduction):
Graphene is an extremely diverse material, and can be combined with other elements (including gases and metals) to produce different materials with various superior properties. Researchers all over the world continue to constantly investigate and patent graphene to learn its various properties and possible applications, which include:
batteries
transistors
computer chips
energy generation
supercapacitors
DNA sequencing
water filters
antennas
touchscreens (for LCD or OLED displays)
solar cells
Spintronics-related products
So, a perfect interface in the human body to be connected to and manipulated by the AI, through 5G network?!
As human beings, we have a natural right to say – NO.
…
Did not see that the link in your first sentence is the link to the study from the University of Almeria. I made a comment about that study https://projectavalon.net/forum4/showthread.php?115033-Why-do-magnets-stick-to-a-vaxxed-person-s-arm-at-the-injection-site&p=1438565&viewfull=1#post1438565
[QUOTE=sms;1438568]
Did not see that the link in your first sentence is the link to the study from the University of Almeria. I made a comment about that study https://projectavalon.net/forum4/showthread.php?115033-Why-do-magnets-stick-to-a-vaxxed-person-s-arm-at-the-injection-site&p=1438565&viewfull=1#post1438565
The fact which can not be denied is: graphene is present not only in the Pfizer vaccine, but also in others.
BREAKING: Graphene Oxide has been found in AstraZeneca vaccination vial (https://www.orwell.city/2021/07/graphene-oxide-in-astrazeneca-vaccination-vial.html)
..
Celeste Solum on graphene and hydrogel
https://www.bitchute.com/video/FFKljVOu7MvM/
jaybee
7th July 2021, 06:46
.
when I went to the link ... https://www.laquintacolumna.net/
there was an article discussing further the expose about the graphene oxide...
at one point after the translation the link broke and then there was a problem with getting the translation back - but then it translated... this made me think that there was some interference with spreading knowledge about this subject so I copied and pasted the article in full to put here for anyone interested...
the article is as follows - (and can be found on the link above)
********************************************
The debate on graphene in vaccines continues. Who is Pablo Campra Madrid, the scientist who directs the research?
SHARE
Enviar a un amigoCompartir en FriendFeedDiggsubmit to reddit
TAGS
CampraScientificDebateGrapheneInvestigationVaccines
Pablo Campra Madrid,
By Magdalena del Amo.- Two days after the preliminary report was made public that confirms reasonable indications about the existence of graphene oxide in COVID vaccines, and in the absence of a conclusive study, a suspect anonymous statement, without signature or seal, which claims to represent to the University of Almería, denies the investigation. Are we dealing with an authentic document or is it a forgery?
The preliminary report on graphene spread like wildfire on social media and was soon translated into several languages. A coup that the system did not expect, which made it activate the most immediate artillery, with the botch of an internet blackout throughout the municipality from where Fifth Column TV broadcasts. Chance? Rather, everything points to causality. On this occasion, the misinformation of maldita.es was of little use, always so eager to feed its followers with good carrion.
The scientist in charge of the research is Pablo Campra Madrid, a graduate in biology, a doctorate in Chemical Sciences and a full professor at the University of Almería. The curriculum is not bad, despite the comment of some bad language insinuating that the author would be "a pelao pal". Admittedly, they have been saying too many inconveniences in the last two weeks. I still do not understand. But, before continuing, I find myself in the need to clarify some details about this mess.
First of all, I am not at war with anyone. Amicus plate sed magis amica veritas, or what is the same, "Plato is a friend, but more friend is the truth." A journalist must bear this in mind. The truth is that as a result of the last articles that I published, reporting the very possible existence of graphene oxide in COVID vaccines, according to the aforementioned preliminary analysis of a scientific team from the University of Almería, commissioned by Ricardo Delgado , a gap has been created between several professionals, who do not admit this line of research. Another item, some deny that this extreme is important and insist that it hurts because it "distracts from the main thing." The latter is the phrase of a friend, an expert in Law, with whom I have a sincere and close relationship. Other people have questioned my position in favor of the graphene hypothesis, even hinting that I was being manipulated by Ricardo Delgado and Dr. José Luis Sevillano. It is not like this; I am not easy to manipulate. I am quite seasoned in diving through the stormy seas of "sensitive" information, sometimes with dangerous levels of contamination, even with the incursion of the odd shark. This is not the case.
It must be said that the opinion is not generalized among the dissidents. Dr. Ángel Ruiz Valdepeñas stated this on his social networks with this comment:
“Although these reports are not 100% conclusive, they point with almost certainty to the presence of graphene in the Comirmaty vaccine. Congratulations to Ricardo Delgado and Dr. José Luis Sevillano for their research! Now we have even more arguments to reject these poisonous inoculations that are killing and injuring so many human beings. "
Delgado and Sevillano are complying with their deontological codes by following Aridana's thread, in this Covidian labyrinth, which follows the trail of the dreaded minotaur, which is none other than the possible truth about this "monstrous thing", with the appearance of a vaccine, with a unspeakable and secret content, with terrible adverse effects and many deaths, which are not reported because they are placed under the heading of "coincidence". Family members silence the cause of death of their loved ones; not out of shame as was the case with syphilis or tuberculosis of yesteryear, but because of the manipulation of doctors, duly trained by the "experts" of the laboratories, with the complicity of all our politicians.
I am not manipulated. As an investigative journalist, I investigate, process, deduce and publish, always leaving an open door on those topics on which we do not have the full answer, because new investigations or complementary works are pending. And this happens in this case. Ricardo Delgado and Dr. José Luis Sevillano have started a study that has “resonated” with us from the beginning. Perhaps because already in the month of March 2020 we already intuited that the vaccines would include nanoparticles of "something" or the announced chips. Not because we had dreamed of it, but because we know the high-level research that has been carried out since the end of the Second World War, aimed at controlling society, and because Gates himself let us know through his talk on ID2020 quantum dots, a revolutionary invention to do us the great favor of having us all registered. According to him, many disadvantaged people on the planet do not even exist legally. What a great benefactor!
For this reason, when the "magnetized" or pseudomagnetized began to appear and graphene entered the scene, I must confess that, in my mind, something clicked that led me to read the bibliography on the different applications of graphene that, for me comfort, it was duly selected and available on the website of the Fifth Column, which I appreciate.
All research has invisible and subtle paths, apart from requiring a good dose of intuition. Intuition is not something mysterious, but an unconscious process of response, based on the information that the brain has stored in the different brain structures and dimensions. We see it frequently in police investigations, forensic science, archaeological surveys, and other areas. First it is sensed and then it is sought.
This does not mean that I do not value the research carried out by virologists and the rest of the professionals who have been fighting for the truth since the beginning of this misnamed health crisis, from whose sources I have drunk, such as Dr. María José Martínez Albarracín, whom I value and I estimate, not only for his professional worth, but for his human qualities. I think that, as I have already expressed in other articles, everything is compatible, since, in my opinion, vaccines are multiple and varied, since they are an "experiment within an experiment", and the show has only just begun. Another thing is that they achieve their purposes. We will do our best to stop you.
Returning to the supposed false denial, I would not be surprised if the University of Seville spoke out against the research, if not now, in the very near future, due to pressure or due to its own ideology. Let us not forget that universities, as well as colleges of doctors, psychologists or scientific teams also serve the system, and react when hot topics are raised that can destabilize institutional lies. In these highly bureaucratic collectives, riddled with rules and protocols, it is forbidden to think on your own. Let us not forget the persecutions and convictions of Dr. Ryke Hamer, already emblematic, for his contributions to the cure of cancer and, in general, to Germanic New Medicine; or Dr. Andrew Wakefield for discovering the relationship between autism and the MMR vaccine, known in Spain as triple viral, children are inoculated. The system is unforgiving when someone dares to contradict scientific or social dogmas. That said, we find the signature of an independent scientist as reliable as that of a university. Understand what I mean. Another thing is the legal aspect, in order to present allegations to stop the vaccination process, and that these are admitted as they are not based on the papers.
We have made some inquiries about Dr. Pablo Campra Madrid, the author of the investigation and signatory of the preliminary document and we have found something very positive. From the outset, he has no problem in investigating and dispenses with apriorisms. Science is that. The other is fanaticism and fear of the truth. We have found that you have long supported physicians working with alternative remedies with their research. He demonstrated this with his analysis of the maligned chlorine dioxide, a taboo, prohibited subject that, paradoxically, saved so many lives and continues to save. An inconclusive analysis, with many indications of the efficacy of chlorine dioxide, which Dr. Campra expresses with these words [1]:
“What has been seen in published trials is that it oxidizes a large amount of virus. The plates stay at 99%, kill them all. So that is likely to act on plasma as well. Everything is likely, because there is nothing published. All we have is a great deal of reasonable evidence of efficacy, which comes to us from our Hispanic American colleagues; The good thing here is that Vanguard Science is being done in Spanish. This is not carried by the Anglo-Saxons, we carry it in Spanish. The investigation is very blocked, so this is a good thing. I think the vanguard in COVID-19 therapies is being done in Spanish ”.
Dr. Cambra refers to his colleagues from COMUSAV, a group of which doctors from Latin America are members in a number of over twenty thousand. It is shameful that funds are wasted for design climate change and other ideologizing issues and, instead, projects are not financed for the benefit of humanity.
In closing, I want to say once again that this artificially created pandemic is very surreal and cannot be analyzed logically. Other parameters work here. It cannot be understood if the graph of the strategies designed by the New World Order in the last decades is not known. That is why investigative journalism is so important at this time when it comes to ordering the different loose pieces of virologists, biologists, police officers and other institutions. For those of us who know fresco, not by infused science, but by having researched full time for many years, it is easier for us to understand. That is why we warn and insist so much. And this is one of my tasks, which I elevate to the rank of sacred, because only commitment moves me, bring to the general public the discoveries that I am making and consider important for our life and evolution. Sharing is a way of thanking the Creator for the talents with which I came into this life, which I try to multiply and share. As simple as that. A thousand blessings.
NOTES:
https://madridmarket.es/dr-pablo-campra-lo-que-se-ha-visto-en-ensayos-publicados-es-que-el-dioierto-de-cloro-oxida-gran-cantidad- virus-plaques-stay-at-99-kills-them-all-then-that's-likely-that /
******************************************
Philippe
7th July 2021, 06:56
Chrifri,
Thank you for checking the spanish source and putting some things straight.
On the other hand Jim Stone is stating as fact: If the Pfizer vax was mostly graphene, it would be black
Do we know if reduced graphene can be colorless?
Hereunder is a long, long list of scientific papers that also explain graphene as a good conductor of electricity
https://www.nature.com/articles/s41428-020-0350-9
Graphene oxide-incorporated hydrogels for biomedical applications
For instance:
68.
Yang C, Liu Z, Chen C, Shi K, Zhang L, Ju X-J, et al. Reduced graphene oxide-containing smart hydrogels with excellent electro-response and mechanical properties for soft actuators. ACS Appl Mater Interfaces. 2017;9:15758–67.
69.
Ren J, Zhang A, Zhang L, Li Y, Yang W. Electrically conductive and mechanically tough graphene nanocomposite hydrogels with self-oscillating performance. Polym Int. 2019;68:1146–54.
Reassuring all these chinese scientists, isn't it ?
jaybee
7th July 2021, 08:01
Official sources never talk about how many lipid nanoparticles carrying the spike protein code are in each injection -
Dr Sherri Tenpenny a while back said that she had read one of the patents for a covid 'vaccine' and there were around 50 billion...
If graphene oxide is used in the structure of the lipid nanoparticle then perhaps this is why there is such a high content - (that ultimately could be used in conjunction with 5G as well..?)
I had a little look and there is a connection I think - for example from this link...
I don't claim to fully understand what is being said but I think I get the gist ... :)
https://pubs.rsc.org/en/content/articlelanding/2019/nr/c8nr09245a#!divAbstract
Graphene oxide (GO) is a single-atomic-layered material made of a sheet of oxidized carbon atoms arranged in a honeycomb structure. Thanks to the notable physical and chemical properties of GO, GO-based nanomaterials have applications in many fields of research, including gene delivery. It has been reported that pristine GO can absorb single-stranded DNA and RNA through π–π stacking, which cannot be used as a gene carrier because it is hard to load double-stranded DNA (dsDNA). To tackle this issue, this work was aimed at developing a hybrid nanoparticle (NP) system made of GO coated with cationic lipids (hereafter referred to as GOCL) with suitable physical–chemical properties for gene delivery applications. To this end, nanosized GO flakes (nGO) were coated with the cationic lipid 1,2-dioleoyl-3-trimethylammonium-propane (DOTAP) by microfluidic mixing. Comprehensive characterization of GOCL NPs was performed by a combination of dynamic light scattering (DLS), micro-electrophoresis and atom force microscopy (AFM). Our results show that GOCL NPs exhibit adequate size (<150 nm) and surface charge (ξ = +15 mV) for gene delivery purposes.
chrifri
7th July 2021, 10:01
.
when I went to the link ... https://www.laquintacolumna.net/
there was an article discussing further the expose about the graphene oxide...
at one point after the translation the link broke and then there was a problem with getting the translation back - but then it translated... this made me think that there was some interference with spreading knowledge about this subject so I copied and pasted the article in full to put here for anyone interested...
the article is as follows - (and can be found on the link above)
********************************************
The debate on graphene in vaccines continues. Who is Pablo Campra Madrid, the scientist who directs the research?
SHARE
Enviar a un amigoCompartir en FriendFeedDiggsubmit to reddit
TAGS
CampraScientificDebateGrapheneInvestigationVaccines
Pablo Campra Madrid,
By Magdalena del Amo.- Two days after the preliminary report was made public that confirms reasonable indications about the existence of graphene oxide in COVID vaccines, and in the absence of a conclusive study, a suspect anonymous statement, without signature or seal, which claims to represent to the University of Almería, denies the investigation. Are we dealing with an authentic document or is it a forgery?
The preliminary report on graphene spread like wildfire on social media and was soon translated into several languages. A coup that the system did not expect, which made it activate the most immediate artillery, with the botch of an internet blackout throughout the municipality from where Fifth Column TV broadcasts. Chance? Rather, everything points to causality. On this occasion, the misinformation of maldita.es was of little use, always so eager to feed its followers with good carrion.
The scientist in charge of the research is Pablo Campra Madrid, a graduate in biology, a doctorate in Chemical Sciences and a full professor at the University of Almería. The curriculum is not bad, despite the comment of some bad language insinuating that the author would be "a pelao pal". Admittedly, they have been saying too many inconveniences in the last two weeks. I still do not understand. But, before continuing, I find myself in the need to clarify some details about this mess.
First of all, I am not at war with anyone. Amicus plate sed magis amica veritas, or what is the same, "Plato is a friend, but more friend is the truth." A journalist must bear this in mind. The truth is that as a result of the last articles that I published, reporting the very possible existence of graphene oxide in COVID vaccines, according to the aforementioned preliminary analysis of a scientific team from the University of Almería, commissioned by Ricardo Delgado , a gap has been created between several professionals, who do not admit this line of research. Another item, some deny that this extreme is important and insist that it hurts because it "distracts from the main thing." The latter is the phrase of a friend, an expert in Law, with whom I have a sincere and close relationship. Other people have questioned my position in favor of the graphene hypothesis, even hinting that I was being manipulated by Ricardo Delgado and Dr. José Luis Sevillano. It is not like this; I am not easy to manipulate. I am quite seasoned in diving through the stormy seas of "sensitive" information, sometimes with dangerous levels of contamination, even with the incursion of the odd shark. This is not the case.
It must be said that the opinion is not generalized among the dissidents. Dr. Ángel Ruiz Valdepeñas stated this on his social networks with this comment:
“Although these reports are not 100% conclusive, they point with almost certainty to the presence of graphene in the Comirmaty vaccine. Congratulations to Ricardo Delgado and Dr. José Luis Sevillano for their research! Now we have even more arguments to reject these poisonous inoculations that are killing and injuring so many human beings. "
Delgado and Sevillano are complying with their deontological codes by following Aridana's thread, in this Covidian labyrinth, which follows the trail of the dreaded minotaur, which is none other than the possible truth about this "monstrous thing", with the appearance of a vaccine, with a unspeakable and secret content, with terrible adverse effects and many deaths, which are not reported because they are placed under the heading of "coincidence". Family members silence the cause of death of their loved ones; not out of shame as was the case with syphilis or tuberculosis of yesteryear, but because of the manipulation of doctors, duly trained by the "experts" of the laboratories, with the complicity of all our politicians.
I am not manipulated. As an investigative journalist, I investigate, process, deduce and publish, always leaving an open door on those topics on which we do not have the full answer, because new investigations or complementary works are pending. And this happens in this case. Ricardo Delgado and Dr. José Luis Sevillano have started a study that has “resonated” with us from the beginning. Perhaps because already in the month of March 2020 we already intuited that the vaccines would include nanoparticles of "something" or the announced chips. Not because we had dreamed of it, but because we know the high-level research that has been carried out since the end of the Second World War, aimed at controlling society, and because Gates himself let us know through his talk on ID2020 quantum dots, a revolutionary invention to do us the great favor of having us all registered. According to him, many disadvantaged people on the planet do not even exist legally. What a great benefactor!
For this reason, when the "magnetized" or pseudomagnetized began to appear and graphene entered the scene, I must confess that, in my mind, something clicked that led me to read the bibliography on the different applications of graphene that, for me comfort, it was duly selected and available on the website of the Fifth Column, which I appreciate.
All research has invisible and subtle paths, apart from requiring a good dose of intuition. Intuition is not something mysterious, but an unconscious process of response, based on the information that the brain has stored in the different brain structures and dimensions. We see it frequently in police investigations, forensic science, archaeological surveys, and other areas. First it is sensed and then it is sought.
This does not mean that I do not value the research carried out by virologists and the rest of the professionals who have been fighting for the truth since the beginning of this misnamed health crisis, from whose sources I have drunk, such as Dr. María José Martínez Albarracín, whom I value and I estimate, not only for his professional worth, but for his human qualities. I think that, as I have already expressed in other articles, everything is compatible, since, in my opinion, vaccines are multiple and varied, since they are an "experiment within an experiment", and the show has only just begun. Another thing is that they achieve their purposes. We will do our best to stop you.
Returning to the supposed false denial, I would not be surprised if the University of Seville spoke out against the research, if not now, in the very near future, due to pressure or due to its own ideology. Let us not forget that universities, as well as colleges of doctors, psychologists or scientific teams also serve the system, and react when hot topics are raised that can destabilize institutional lies. In these highly bureaucratic collectives, riddled with rules and protocols, it is forbidden to think on your own. Let us not forget the persecutions and convictions of Dr. Ryke Hamer, already emblematic, for his contributions to the cure of cancer and, in general, to Germanic New Medicine; or Dr. Andrew Wakefield for discovering the relationship between autism and the MMR vaccine, known in Spain as triple viral, children are inoculated. The system is unforgiving when someone dares to contradict scientific or social dogmas. That said, we find the signature of an independent scientist as reliable as that of a university. Understand what I mean. Another thing is the legal aspect, in order to present allegations to stop the vaccination process, and that these are admitted as they are not based on the papers.
We have made some inquiries about Dr. Pablo Campra Madrid, the author of the investigation and signatory of the preliminary document and we have found something very positive. From the outset, he has no problem in investigating and dispenses with apriorisms. Science is that. The other is fanaticism and fear of the truth. We have found that you have long supported physicians working with alternative remedies with their research. He demonstrated this with his analysis of the maligned chlorine dioxide, a taboo, prohibited subject that, paradoxically, saved so many lives and continues to save. An inconclusive analysis, with many indications of the efficacy of chlorine dioxide, which Dr. Campra expresses with these words [1]:
“What has been seen in published trials is that it oxidizes a large amount of virus. The plates stay at 99%, kill them all. So that is likely to act on plasma as well. Everything is likely, because there is nothing published. All we have is a great deal of reasonable evidence of efficacy, which comes to us from our Hispanic American colleagues; The good thing here is that Vanguard Science is being done in Spanish. This is not carried by the Anglo-Saxons, we carry it in Spanish. The investigation is very blocked, so this is a good thing. I think the vanguard in COVID-19 therapies is being done in Spanish ”.
Dr. Cambra refers to his colleagues from COMUSAV, a group of which doctors from Latin America are members in a number of over twenty thousand. It is shameful that funds are wasted for design climate change and other ideologizing issues and, instead, projects are not financed for the benefit of humanity.
In closing, I want to say once again that this artificially created pandemic is very surreal and cannot be analyzed logically. Other parameters work here. It cannot be understood if the graph of the strategies designed by the New World Order in the last decades is not known. That is why investigative journalism is so important at this time when it comes to ordering the different loose pieces of virologists, biologists, police officers and other institutions. For those of us who know fresco, not by infused science, but by having researched full time for many years, it is easier for us to understand. That is why we warn and insist so much. And this is one of my tasks, which I elevate to the rank of sacred, because only commitment moves me, bring to the general public the discoveries that I am making and consider important for our life and evolution. Sharing is a way of thanking the Creator for the talents with which I came into this life, which I try to multiply and share. As simple as that. A thousand blessings.
NOTES:
https://madridmarket.es/dr-pablo-campra-lo-que-se-ha-visto-en-ensayos-publicados-es-que-el-dioierto-de-cloro-oxida-gran-cantidad- virus-plaques-stay-at-99-kills-them-all-then-that's-likely-that /
******************************************
Thanks Jaybee
Very good statement from laquinta indeed. Personally I believe that GO nanoparticles and other not so healthy stuff is in the vaxxx.
The statement from laquinta as such, confirms that what Dr. Ruby was saying or Markov writing is not correct, or only partially correct. The problem with the kind of people like Dr. Ruby is that they pick up something that they believe will give them the attention/spotlight they are looking for and then tell us with some kind of authority that what they say is correct, well researched etc, which definitely is not always the case. If the Dr. Ruby kind of people, with their sensationalized way of presenting information and sometimes half-truths, really would help some people to be sufficiently informed about the vaxxx in order to take a well based decision regarding the vaxxxination, than this kind of journalism would definitely be OK with me. However, I doubt that the pro vaxxx people and even those still on the fence, are watching such information channels. For those that already have doubts about the vaxxx or are convinced that the vaxxx is not good at all, such sensationalized information does in my opinion not help much. To find out more about the topic the information from serious sources, like American Frontline Doctors, Dr. Sukarit Bakthi, Dr. Tenpenny and her group, Dr. Wolfgang Wodarg etc are in my opinion more helpful
Journeyman
7th July 2021, 10:24
Chifri,
Thank you for checking the spanish source and putting some things straight.
On the other hand Jim Stone is stating as fact: If the Pfizer vax was mostly graphene, it would be black
Do we know if reduced graphene can be colorless?
Hereunder is a long, long list of scientific papers that also explain graphene as a good conductor of electricity
https://www.nature.com/articles/s41428-020-0350-9
Graphene oxide-incorporated hydrogels for biomedical applications
For instance:
68.
Yang C, Liu Z, Chen C, Shi K, Zhang L, Ju X-J, et al. Reduced graphene oxide-containing smart hydrogels with excellent electro-response and mechanical properties for soft actuators. ACS Appl Mater Interfaces. 2017;9:15758–67.
Reassuring all these chinese scientists, isn't it ?
I'd also like to thank @Chilfri for such a thorough job on that post above, very useful!
GO already been tested as an adjuvant in nasally administered vaccines: https://www.graphene-info.com/graphene-oxide-gives-boost-new-intranasal-flu-vaccine
Made me wonder about those stories about the PCR swabs.
greybeard
7th July 2021, 10:55
STEW PETERS - SCIENTIFIC PROOF COVID INJECTIONS ARE MASS POISONING!
This is dynamic --well worth a listen
The PCR test is not fit for purpose and is used to perpetrate this mass propaganda and jab roll out.
This "virus" has never been isolated.
All in the video
Chris
https://www.bitchute.com/video/zWALHa8c8wFm/
jaybee
7th July 2021, 11:08
Thanks Jaybee
Very good statement from laquinta indeed. Personally I believe that GO nanoparticles and other not so healthy stuff is in the vaxxx.
The statement from laquinta as such, confirms that what Dr. Ruby was saying or Markov writing is not correct, or only partially correct. The problem with the kind of people like Dr. Ruby is that they pick up something that they believe will give them the attention/spotlight they are looking for and then tell us with some kind of authority that what they say is correct, well researched etc, which definitely is not always the case. If the Dr. Ruby kind of people, with their sensationalized way of presenting information and sometimes half-truths, really would help some people to be sufficiently informed about the vaxxx in order to take a well based decision regarding the vaxxxination, than this kind of journalism would definitely be OK with me. However, I doubt that the pro vaxxx people and even those still on the fence, are watching such information channels. For those that already have doubts about the vaxxx or are convinced that the vaxxx is not good at all, such sensationalized information does in my opinion not help much. To find out more about the topic the information from serious sources, like American Frontline Doctors, Dr. Sukarit Bakthi, Dr. Tenpenny and her group, Dr. Wolfgang Wodarg etc are in my opinion more helpful
I don't mind the way Dr Ruby (via the Stew Peters show) delivers her findings - it could be termed sensationalism but that is no different from the way the Official Narrative declares the vaccine 'safe and effective' which is just as sensational plus, in fact, dangerous - not to mention illogical when it is experimental and not tested for long term effects...
Bottom line.... if there is a large content of Graphene oxide in the injection (for whatever reason) and that proves to be injurious to heath (and / or fatal...)..... the injections will work like a biological weapon... and there are grave concerns that that is exactly what it may turn out to be... but by then it will be too late as the big rush to jab the world has been quite successful....
Graphene in the vaxxx. In the first shot or in the second shot? Just asking. Maybe in the first shot the DNA changing stuff and in the second shot the graphene?
In the Spanish study (https://www.docdroid.net/Ov1M99x/official-interim-report-in-english-university-of-almeria-pdf), almost all what was found in the Pfizer vaccine, was graphene.
La Quinta Columna: '98% to 99% of the vaccination vial is graphene oxide' (https://www.orwell.city/2021/07/graphene-oxide.html)
I guess, that would be all needed to accomplish the agenda, i.e. the installation of an interface into the human body?! The stories about mRNA, spike-proteins etc. could be just parts of a huge smoke screen?!
And, the vaccines would be just one delivery method, as it seems that we have been sprayed by graphene, as well – LINK (https://www.bitchute.com/video/fN5plldFJbOE/)
..
Bill Ryan
7th July 2021, 12:42
vgugdz
This may or may not be important, but I'd be pretty sure Dr Jane Ruby isn't a medical doctor.
Shortly after 3:10 she makes a goof that no doctor (or biochemist of any kind) would make. She refers to the ratio of 6 nanograms per uL (which she pronounces "Yoo-Ell") of RNA.
It's not "You-Ell". The 'u' in 'uL' is often typed that way in biochemical texts because it's easier and quicker with a regular keyboard. But it's not a 'u'. It's the Greek letter universally used for 'micro', and the correct symboil is μl. She should have said 6 nanograms per microliter.
For what that may be worth, that's a FAIL. It might seem like a tiny thing, but scientists among the readers here will understand. (And for the record, right now I don't believe this high graphene ratio at all.)
:focus:
Graphene in the vaxxx. In the first shot or in the second shot? Just asking. Maybe in the first shot the DNA changing stuff and in the second shot the graphene?
In the Spanish study (https://www.docdroid.net/Ov1M99x/official-interim-report-in-english-university-of-almeria-pdf), almost all what was found in the Pfizer vaccine, was graphene.
La Quinta Columna: '98% to 99% of the vaccination vial is graphene oxide' (https://www.orwell.city/2021/07/graphene-oxide.html)
I guess, that would be all needed to accomplish the agenda, i.e. the installation of an interface into the human body?! The stories about mRNA, spike-proteins etc. could be just parts of a huge smoke screen?!
And, the vaccines would be just one delivery method, as it seems that we have been sprayed by graphene, as well – LINK (https://www.bitchute.com/video/fN5plldFJbOE/)
..
I would not say smokescreen, as there are numerous reliable doctors/ microbiologist attesting to spike protein via mRNA , even going in details how it works and they are consistent in their views, but rather another aspect of a multi pronged attack on humanity. Like if one or two bullet miss you the 3rd or 4th can do the job.
Celeste Solum said its a graphene base hydrogel graphene has a electromagnetic and mechanical properties, its the material that hooks to the internet while hydrogel is able to attach to DNA. so basically graphene base hydrogel is the interface between internet and man. there is more to the video I posted.
jaybee
7th July 2021, 13:26
Dr Jane Ruby isn't a medical doctor - (tbh I didn't think she was...)
I think this is her...
https://www.imdb.com/name/nm9616350/bio
Jane Ruby is a Washington, DC based television personality, New Right political pundit, film producer, author of "A Sea of New Media" and has hosted several television shows such as Dr Jane's DC and InsideLookTV Magazine. A graduate of the University of Rochester, she holds two doctoral degrees in Education and Psychcology, two Masters Degrees in Nursing and International Health Economics and is highly published in global health economics as well as contemporary media and social issues books and articles. Her website contains blog posts and interviews of and by her.
Bill Ryan
7th July 2021, 13:33
As an interesting additional comment, I received this by email forwarding a statement from a scientist who was said to be in a position to know.
~~~
The Spanish research article is mostly nonsense, but there could be graphene oxide in one or more of the Covid vaccines. The actual makeup of the vaccines is never disclosed, but most of the experimental vaccines designed by these companies use graphene oxide or graphene compounds to stabilize. It is the "secret sauce" that does most of the long term damage.
jaybee
7th July 2021, 13:52
Graphene in the vaxxx. In the first shot or in the second shot? Just asking. Maybe in the first shot the DNA changing stuff and in the second shot the graphene?
In the Spanish study (https://www.docdroid.net/Ov1M99x/official-interim-report-in-english-university-of-almeria-pdf), almost all what was found in the Pfizer vaccine, was graphene.
La Quinta Columna: '98% to 99% of the vaccination vial is graphene oxide' (https://www.orwell.city/2021/07/graphene-oxide.html)
I guess, that would be all needed to accomplish the agenda, i.e. the installation of an interface into the human body?! The stories about mRNA, spike-proteins etc. could be just parts of a huge smoke screen?!
And, the vaccines would be just one delivery method, as it seems that we have been sprayed by graphene, as well – LINK (https://www.bitchute.com/video/fN5plldFJbOE/)
..
I went to the 2nd link in your post and there was an article about graphene oxide in the AstraZeneca jab as well...
https://www.orwell.city/2021/07/graphene-oxide-in-astrazeneca-vaccination-vial.html
now I don't know what's going on with it all but I could speculate that if graphene oxide is part of the (50 billion) lipid nanoparticles that carries the spike protein code and 'drives' it into the human cell - it could be a double whammy - spike protein delivery AND something else connected to the Internet of Things / Smart Cities / 5G etc...
The Baddies (booooo hissss :) ) who want to turn us all into Transhumans haven't gone to all the trouble of pushing the Fake Pandemic and Fake Vaccination Programme for nothing - just to kill off a billion or two people.. this could be it - their big move - their secret Shock and Awe...
Gwin Ru
7th July 2021, 14:15
...
... anyone remembers this:
https://projectavalon.net/forum4/images/misc/quote_icon.png Posted by Hervé (here) (https://projectavalon.net/forum4/showthread.php?p=638097#post638097)
Going down from Micro to Nano, from http://www.sfgate.com/business/article/Cal-physicists-make-a-radio-10-000-times-thinner-3235246.php#photo-2378250:
**********************************
Cal physicists make a radio 10,000 times thinner than a human hair
Bernadette Tansey, San Francisco Chronicle
Bernadette Tansey, Chronicle Staff Writer
Published 4:00 am, Thursday, November 1, 2007
http://ww2.hdnux.com/photos/11/04/50/2378249/9/628x471.jpg (http://www.sfgate.com/business/article/Cal-physicists-make-a-radio-10-000-times-thinner-3235246.php#next)
This simulation shows the electric field surrounding the nanotube radio during radio operation. Notice how the field is strongest at the tip of the nanotube and how the field varies as the nanotube vibrates. This effect allows the nanotube radio to demodulate radio signals. Courtesy Zettl Research Group, Lawrence Berkeley National Laboratory and University of California at Berkeley Photo: Zettl Research Group, Lawrence Berkeley National Laboratory
http://ww3.hdnux.com/photos/11/04/50/2378250/9/628x471.jpg (http://www.sfgate.com/business/article/Cal-physicists-make-a-radio-10-000-times-thinner-3235246.php#next)
Nanotube radio (2007). Photo courtesy of Zettl Research Group, Lawrence Berkeley National Laboratory and University of California at Berkeley
Physicists at UC Berkeley say they have produced the world's smallest radio out of a single carbon nanotube that is 10,000 times thinner than a human hair.
Professor Alex Zettl (http://www.sfgate.com/?controllerName=search&action=search&channel=technology&search=1&inlineLink=1&query=%22Alex+Zettl%22) led a team that developed the minuscule filament, which can be tuned to receive AM or FM transmissions.
The first song it played? "Layla" by Derek & the Dominos. Eric Clapton (http://www.sfgate.com/?controllerName=search&action=search&channel=technology&search=1&inlineLink=1&query=%22Eric+Clapton%22)'s unmistakable guitar riff can be heard on a scratchy recording of the nanoradio's output posted by Zettl online.
Zettl said the device, built by graduate student Kenneth Jensen (http://www.sfgate.com/?controllerName=search&action=search&channel=technology&search=1&inlineLink=1&query=%22Kenneth+Jensen%22), is the first radio within the size range of nanotechnology, which covers inventions no larger than 100 billionths of a meter. The nanoradio is 100 billion times smaller than the first commercial radios of the early 20th century. It is a thousand times smaller than the most minute radios in use today, which are based on silicon chip technology.
The research team has no commercial partners yet, but Zettl said the practical applications of the nanoradio could include cell phones, climate-monitoring systems and radio-controlled diagnostic probes that could move through the human bloodstream.
"Maybe the kids will be wearing these instead of iPods, inside their ears," Zettl said.
As long as 10 years ago, scientists had managed to build individual components of a radio on the nanoscale, he said. But Zettl and his colleagues figured out how to make a single nanotube perform all the functions of a radio: It serves as an antenna, tuner, amplifier and demodulator. The demodulator eliminates any frequencies from a radio transmission except the signal to be played, such as a song.
"I hate to sound like I'm selling a Ginsu knife - 'But wait, there's more! It also slices and dices!' - but this one nanotube does everything," Zettl said.
The key to this feat was making the nanoradio work differently from conventional radio electronics. The first step in that old technology is to convert radio waves into pulses of electronic current. By contrast, the nanotube absorbs the radio transmission and physically vibrates in response, like a tuning fork or the tiny hairlike structures inside the human ear. The filament has one end mounted in an electrode, but the other end is free. Its vibrations change the patterns in an electric field created by a battery. The varying electronic patterns become sounds or music audible through headphones.
Jensen's (http://www.sfgate.com/?controllerName=search&action=search&channel=technology&search=1&inlineLink=1&query=%22Jensen%27s%22) choice for one of the first songs played on the nanoradio was "Good Vibrations (http://www.sfgate.com/?controllerName=search&action=search&channel=technology&search=1&inlineLink=1&query=%22Good+Vibrations%22)" by the Beach Boys (http://www.sfgate.com/?controllerName=search&action=search&channel=technology&search=1&inlineLink=1&query=%22Beach+Boys%22).
But there is indeed more. The nanotube can also function as a transmitter. Theoretically, thousands of nanoradios distributed through the air or in the bloodstream could send back signals about air quality or the state of a patient's cells, Zettl said.
Carbon nanotubes are immensely strong compounds made of carbon atoms linked in a structure that looks like chicken wire. The carbon sheets can be formed into hollow tubes. Zettl's research team tweaked the nanotube structures and found that multi-walled cylinders - tubes within tubes - were better for picking up AM and FM transmissions. Single-walled nanotubes were best for receiving the frequencies used in cell phones.
The team built a transmitter in the lab based on conventional electronics, and first proved that the nanoradio could pick up and play "Layla" about 10 months ago. But the scientists held the news for publication in the journal Nano Letters, which posted it online on Wednesday. Along with Jensen and Zettl, the co-authors of the paper were UC Berkeley postdoctoral fellow Jeff Weldon (http://www.sfgate.com/?controllerName=search&action=search&channel=technology&search=1&inlineLink=1&query=%22Jeff+Weldon%22) and physics graduate student Henry Garcia (http://www.sfgate.com/?controllerName=search&action=search&channel=technology&search=1&inlineLink=1&query=%22Henry+Garcia%22). The project was funded by the National Science Foundation (http://www.sfgate.com/?controllerName=search&action=search&channel=technology&search=1&inlineLink=1&query=%22National+Science+Foundation%22) and the Department of Energy (http://www.sfgate.com/?controllerName=search&action=search&channel=technology&search=1&inlineLink=1&query=%22Department+of+Energy%22).
Hear a recording of the first song ever played on a nanotube radio at sfgate.com/ZBKF.
*************************************
bluestflame
7th July 2021, 15:35
stAIp7NiFyk
full presentation here cTtIPBPSv0U
greybeard
7th July 2021, 18:38
If I was in charge of putting out these "vaccines" I would be inclined to vary the ingredients.
You would not want everyone who received it dropping dead immediately.
I would have some placebo ones, some with mild effects, some short term , some long term.
All the way from mild to extremely serious reactions.
You would not want to scare of the "volunteers"
Chris
onawah
7th July 2021, 18:39
THE ACTUAL CONTENTS INSIDE PFIZER VIALS EXPOSED
7/7/21
https://forbiddenknowledgetv.net/the-actual-contents-inside-pfizer-vials-exposed/
"Dr Jane Ruby joins Stew Peters to discuss a scientific report that just came out from the University of Almería School of Engineering in Spain entitled, “Graphene Oxide Detection in Aqueous Suspension: Observational Study in Optical and Electron Microscopy”, where it was found that each dose of the Pfizer shot “was found to contain 6 ng of RNA and 747 ng of graphene oxide, which is 99.103% of the medication.
Dr Ruby draws our attention to a 2016 study, “Toxicity of graphene-family nanoparticles [GFNs]: a general review of the origins and mechanisms”, which found, “Several typical mechanisms underlying GFN toxicity have been revealed, for instance, physical destruction, oxidative stress, DNA damage, inflammatory response, apoptosis, autophagy, and necrosis.”
She says, “These graphene sheets that investigators found in the Pfizer vial, when they get into your system and when they start to penetrate your cells – which they have a lipid nanoparticle that pushes them into your cells – you get oxidative stress…
“It destroys literally everything inside the cell. It explodes the mitochondria. It creates a situation where the body is on a 10-Alarm fire truck and inflammation, cytokines, chemokines. This incredibly violent…inflammatory storm comes in and it has particular affinity for creating acute inflammation of the lungs, it creates an inflammatory storm in cardiac tissue and in brain tissue.
“Stew, this is going to tie directly to strokes, to the heart attacks – and we’re giving this to pregnant mothers and babies? This is really something everybody’s gotta start paying attention to.”
Stew asks her if graphene oxide is a poison and she responds, “It is most definitely a poison.”
Stew says, “Spanish researchers have found that over 99% of the Pfizer vaccine is graphene oxide, is that right?”
“That’s right. Stew, there’s no other reason for this to be in there except to murder people…If the rest of the companies that are pushing these jabs, all four of the companies in the US are filled with 99% of this toxic industrial chemical, I don’t know what to say to you but everybody better shut everything down right now. This is really dangerous.”
Stew replies, “This is horrific. I get chills listening to this. I don’t know why the media’s not picking any of this up. They’re in on it. They want you dead. They’re part of the murder plot…
“OK, let me ask you question. Aside from pre-meditated murder, what might be another motivation for one to fill another person’s body, their entire make-up with this graphene oxide? What else does this stuff do, other than poison and kill people?”
She responds, “The only other explanation I could come up with, as a scientist, myself is that this is a mass-uninformed, without-consent global experiment, because they’ve never been able to get this into humans on an experimental basis.”
Stew asks, “When they authorized this for emergency use, the efficacy was broadcast everywhere – fake, false lies, complete lies – they said that this thing killed the coronavirus, known as COVID-19, 98.6% success rate, whatever – how can they prove that? Was that just a lie? Did they just make up an arbitrary number? Is that documented anywhere? Does thing really delete or combat the SARS-CoV-2 virus?”
She replies, “Stew, I’m going to go back to the beginning. The PCR test is a fraud perpetrated by Christian Drosten and Olfert Landt. The coronavirus SARS-CoV-2 has never been isolated, its protein sequences have never been demonstrated or validated, no one can prove to us that it ever really existed.
“Did something exist last year? Something flying around now that’s a flu? Lots of different versions of the Common Cold? Yes, yes and yes. But no one’s ever proven or shown an isolate; verified an isolate of the SARS-CoV-2 virus. That’s number one.
“And I want to add one more thing. These Spanish researchers in the group said that when you look at the different symptoms at whatever was the SARS-CoV-2 from last year, or a few residual cases now, they are all symptoms that would also be caused by excess graphene oxide in your body: the storm in the lungs – and by the way, they’re preparing an inhalant version of this “vaccine”. And God help us, Stew, because it’s more potent, it goes right into the lungs and it creates a pulmonary storm of pneumonia right away and you’re gonna see, if they get this into Emergency Use Authorization, you’re gonna start seeing respiratory flash pneumonias and rapid deaths…
“Since the Nuremberg Trials, you cannot experiment on human beings, regardless of the drug, the disease state, you cannot do it without the approval of a Human Subjects Review Board. That’s an independent board that approves your protocol and your informed consent, which no one’s ever seen – a real informed consent about these jabs…
“There’s also some information coming in and we’re going to see more and more of it and we’re going to talk about it, of the fact that when you get your body filled with enough graphene oxide, with the warmth of your body and…if it draws the oxygen into it, that [the graphene oxide] can be manipulated and your body can be affected by…the 5G network, which we haven’t seen be completely set up and rolled-out yet and so there’s a lot of concern around that.
“At that point, it’ll just be the residual people who haven’t died of lung or heart disease from this excess toxic chemical.” "
vgugdz
Eric J (Viking)
7th July 2021, 19:55
Makes you wonder doesn’t it... watch the clip to get the drift!
http://www.youtube.com/watch?v=90OFZQx_7xI
Viking
Arcturian108
7th July 2021, 21:14
If I was in charge of putting out these "vaccines" I would be inclined to vary the ingredients.
You would not want everyone who received it dropping dead immediately.
I would have some placebo ones, some with mild effects, some short term , some long term.
All the way from mild to extremely serious reactions.
You would not want to scare of the "volunteers"
Chris
Exactly my own thoughts on this subject. Thanks Greybeard for putting this out there.
TargeT
7th July 2021, 23:30
Graphene (https://en.wikipedia.org/wiki/Graphene) is an atom thick lattice of carbon... who cares if carbon is in a vaccine for a carbon based life form???
Gwin Ru
7th July 2021, 23:37
BREAKING! AstraZeneca 'Vaccine' Vials Examined by Researchers Confirm TOXIC POISON (https://rumble.com/vjk0u1-breaking-astrazeneca-vaccine-vials-examined-by-researchers-confirm-toxic-po.html) 11:39
Stew Peters Show (https://rumble.com/c/StewPeters)
Published July 7, 2021 1,162 Views
Rumble (https://rumble.com/) — First Pfizer, now AstraZeneca! The toxic substance (poison) that was found in the Pfizer vials by Spanish researchers has now been confirmed to also be the main ingredient in the AstraZeneca vaccine, according to another scientific research group.
Dr. Jane Ruby joined Stew Peters to break the horrific discovery.
vgxuor
www.StewPeters.com (http://www.StewPeters.com)
www.DrJaneRuby.com (http://www.DrJaneRuby.com)
----------------------------------------
One interesting observation from pharmacists is that there are visible/observable differences in vial contents within the same batch/lot!
¤=[Post Update]=¤
Graphene (https://en.wikipedia.org/wiki/Graphene) is an atom thick lattice of carbon... who cares if carbon is in a vaccine for a carbon based life form???Sure... have some crushed diamonds for lunch :P
ExomatrixTV
8th July 2021, 01:25
BREAKING DISCOVERY! The ACTUAL CONTENTS Inside Pfizer Vials EXPOSED!:
https://sp.rmbl.ws/s8/2/v/K/S/8/vKS8b.caa.mp4
source (https://rumble.com/vjgmj9-breaking-discovery-the-actual-contents-inside-pfizer-vials-exposed.html)
Scientists have examined the Pfizer 'vaccine', and what they found was HORRIFIC...It's Poison!
Graphite Oxide (https://en.wikipedia.org/wiki/Graphite_oxide)
Applications and Toxicity (https://www.dovepress.com/applications-and-toxicity-of-graphene-family-nanomaterials-and-their-c-peer-reviewed-fulltext-article-NSA) of Graphene family Nanomaterials and their composites.
UV light exposure (https://www.sciencedirect.com/science/article/abs/pii/S0008622311008244) of aqueous Graphene Oxide suspensions to promote their direct reduction, formation of Graphene–Metal Nanoparticle Hybrids and dye degradation.
1411413151963357185
ExomatrixTV
8th July 2021, 02:09
Graphene-Oxide-Poison-Exposed (http://tinyurl.com/Graphene-Oxide-Poison-Exposed) ... New Evidence Shows Vaccines Are Dangerous!
Tigger
8th July 2021, 02:27
Any chance of getting this video into the Avalon Library?
Eric J (Viking)
8th July 2021, 06:27
¤=[Post Update]=¤
[/COLOR]Here’s what the mainstream research scientists say about the GRAPHENE OXIDE found in the Covid injections.
Posted by Pulmonaria officinalis
Graphene oxide is known to cause cardiotoxicity (1), may function as an electrochemical biosensor (2) using radio frequency or microwaves (3) to detect certain chemicals in the body (4,5). Its use in drug delivery has shown to create a cytokine storm immune response (6), facilitates drug delivery across the BBB (Blood Brain Barrier) (7), and may cause cellular changes such as increased neuronal firing (8). Interestingly, it may be used in Electromagnetogenetics as a basis for mind control (9,10). Graphene nano particles have unique physical, electrical, and chemical properties, and the biological applications are far-reaching.
Zhang J, Cao HY, Wang JQ, Wu GD, Wang L. Graphene Oxide and Reduced Graphene Oxide Exhibit Cardiotoxicity Through the Regulation of Lipid Peroxidation, Oxidative Stress, and Mitochondrial Dysfunction. Front Cell Dev Biol. 2021;9:616888. Published 2021 Mar 18. doi:10.3389/fcell.2021.616888
Liu M, Chen Q, Lai C, et al. A double signal amplification platform for ultrasensitive and simultaneous detection of ascorbic acid, dopamine, uric acid and acetaminophen based on a nanocomposite of ferrocene thiolate stabilized Fe₃O₄@Au nanoparticles with graphene sheet. Biosens Bioelectron. 2013;48:75-81. doi:10.1016/j.bios.2013.03.070
Lee HJ, Yook JG. Graphene Nanomaterials-Based Radio-Frequency/Microwave Biosensors for Biomaterials Detection. Materials (Basel). 2019;12(6):952. Published 2019 Mar 21. doi:10.3390/ma12060952
Speranza G. Carbon Nanomaterials: Synthesis, Functionalization and Sensing Applications. Nanomaterials (Basel). 2021;11(4):967. Published 2021 Apr 9. doi:10.3390/nano11040967
Prasert K, Sutthibutpong T. Unveiling the Fundamental Mechanisms of Graphene Oxide Selectivity on the Ascorbic Acid, Dopamine, and Uric Acid by Density Functional Theory Calculations and Charge Population Analysis. Sensors (Basel). 2021;21(8):2773. Published 2021 Apr 14. doi:10.3390/s21082773
Luo N, Weber JK, Wang S, et al. PEGylated graphene oxide elicits strong immunological responses despite surface passivation. Nat Commun. 2017;8:14537. Published 2017 Feb 24. doi:10.1038/ncomms14537
Su S, Wang J, Qiu J, Martinez-Zaguilan R, Sennoune SR, Wang S. In vitro study of transportation of porphyrin immobilized graphene oxide through blood brain barrier. Mater Sci Eng C Mater Biol Appl. 2020;107:110313. doi:10.1016/j.msec.2019.110313
Pampaloni NP, Lottner M, Giugliano M, et al. Single-layer graphene modulates neuronal communication and augments membrane ion currents. Nat Nanotechnol. 2018;13(8):755-764. doi:10.1038/s41565-018-0163-6
S. A. Stanley, L. Kelly, K. N. Latcha, S. F. Schmidt, X. Yu, A. R. Nectow, J. Sauer, J. P. Dyke, J. S. Dordick, J. M. Friedman, Bidirectional electromagnetic control of the hypothalamus regulates feeding and metabolism. Nature531, 647–650 (2016).
Rastogi SK, Garg R, Scopelliti MG, et al. Remote nongenetic optical modulation of neuronal activity using fuzzy graphene. Proc Natl Acad Sci U S A. 2020;117(24):13339-13349. doi:10.1073/pnas.1919921117
___
https://ncrenegade.com/breaking-discovery-the-actual-contents-inside-pfizer-vials-exposed/
Oops just noticed the same content further up the thread, no harm done!
Viking
jaybee
8th July 2021, 06:55
If I was in charge of putting out these "vaccines" I would be inclined to vary the ingredients.
You would not want everyone who received it dropping dead immediately.
I would have some placebo ones, some with mild effects, some short term , some long term.
All the way from mild to extremely serious reactions.
You would not want to scare of the "volunteers"
Chris
If this is a big human world wide clinical trial involving billions of people and billions / trillions of injections... as it appears to be on one level - being experimental -
It's mind boggling to think how they could keep track of it all... even with an AI data base - especially as the adverse reactions and deaths aren't always designated to the jab... or even reported at all -
Unless this is where the graphene oxide comes into it and it acts as a general body scanner and transmitter of info about what the various affects are and who has what, when and where....
Just a thought that came to me when replying to your post...
palehorse
8th July 2021, 07:38
Any chance of getting this video into the Avalon Library?
here is the mp4 if anyone are interested https://sp.rmbl.ws/s8/2/v/K/S/8/vKS8b.caa.mp4
meat suit
8th July 2021, 07:40
If I was in charge of putting out these "vaccines" I would be inclined to vary the ingredients.
You would not want everyone who received it dropping dead immediately.
I would have some placebo ones, some with mild effects, some short term , some long term.
All the way from mild to extremely serious reactions.
You would not want to scare of the "volunteers"
Chris
If this is a big human world wide clinical trial involving billions of people and billions / trillions of injections... as it appears to be on one level - being experimental -
It's mind boggling to think how they could keep track of it all... even with an AI data base - especially as the adverse reactions and deaths aren't always designated to the jab... or even reported at all -
Unless this is where the graphene oxide comes into it and it acts as a general body scanner and transmitter of info about what the various affects are and who has what, when and where....
Just a thought that came to me when replying to your post...
most likely the selecting, harvesting, killing starts at a later point via 5g or similar. pretty much everybody carries a smart phone near their body now that could trigger something.
if thats the plan than they would want as many people as possible injected before they start the second part of the operation.
all deaths and side effects at this stage are probably just side effects as far as they are concerned.
Reinhard
8th July 2021, 09:37
If I was in charge of putting out these "vaccines" I would be inclined to vary the ingredients.
You would not want everyone who received it dropping dead immediately.
I would have some placebo ones, some with mild effects, some short term , some long term.
All the way from mild to extremely serious reactions.
You would not want to scare of the "volunteers"
Chris
Right!..... not immediately.
That's easy to organize.... considering the "necessary" booster injections in the upcoming months/years.
jaybee
8th July 2021, 10:24
If I was in charge of putting out these "vaccines" I would be inclined to vary the ingredients.
You would not want everyone who received it dropping dead immediately.
I would have some placebo ones, some with mild effects, some short term , some long term.
All the way from mild to extremely serious reactions.
You would not want to scare of the "volunteers"
Chris
If this is a big human world wide clinical trial involving billions of people and billions / trillions of injections... as it appears to be on one level - being experimental -
It's mind boggling to think how they could keep track of it all... even with an AI data base - especially as the adverse reactions and deaths aren't always designated to the jab... or even reported at all -
Unless this is where the graphene oxide comes into it and it acts as a general body scanner and transmitter of info about what the various affects are and who has what, when and where....
Just a thought that came to me when replying to your post...
most likely the selecting, harvesting, killing starts at a later point via 5g or similar. pretty much everybody carries a smart phone near their body now that could trigger something.
if thats the plan than they would want as many people as possible injected before they start the second part of the operation.
all deaths and side effects at this stage are probably just side effects as far as they are concerned.
maybe...
just seen this video on the thread 'The Continuing Search for Truth' # 1751...
The Corbett Report with Whitney Webb- 'The Welcome Leap into Transhumanism..'
https://www.bitchute.com/video/d0XI05h8FmQ/
And while the jabs are certainly about more than the Fake Pandemic... I waver sometimes as more info becomes available that the Population Reduction will come more through infertility than an obvious kill off... and that the main thrust of getting people used to getting injected with god knows what on a regular basis - leading down to children and babies - is to move the evil eugenics Transhuman Agenda forward... (although as you say when 5G becomes part of it who knows where it could go..... and we could still see millions + die in the next 5 years stemming from the jabs..)
It's cutting edge info in the Corbett Report and the people involved must be the most arrogant and monstrous individuals you could ever imagine - actually plotting to redesign the Human Race - and control everything on Earth -
:(
BREAKING! AstraZeneca 'Vaccine' Vials Examined by Researchers Confirm TOXIC POISON (https://rumble.com/vjk0u1-breaking-astrazeneca-vaccine-vials-examined-by-researchers-confirm-toxic-po.html) 11:39
Stew Peters Show (https://rumble.com/c/StewPeters)
Published July 7, 2021 1,162 Views
Rumble (https://rumble.com/) — First Pfizer, now AstraZeneca! The toxic substance (poison) that was found in the Pfizer vials by Spanish researchers has now been confirmed to also be the main ingredient in the AstraZeneca vaccine, according to another scientific research group.
Dr. Jane Ruby joined Stew Peters to break the horrific discovery.
vgxuor
www.StewPeters.com (http://www.StewPeters.com)
www.DrJaneRuby.com (http://www.DrJaneRuby.com)
----------------------------------------
One interesting observation from pharmacists is that there are visible/observable differences in vial contents within the same batch/lot!
¤=[Post Update]=¤
Graphene (https://en.wikipedia.org/wiki/Graphene) is an atom thick lattice of carbon... who cares if carbon is in a vaccine for a carbon based life form???Sure... have some crushed diamonds for lunch :P
Bravo, Gwin Ru! I love your response. I was going to make a similar one but your response outshines mine!! (Pun intended) Isn't it amazing how the structure of an element can change everything.
Billy
8th July 2021, 13:38
N-Acetylcysteine precursor of glutathione, reduces and oxidizes graphite oxide.
Spanish with subtitles, only 8.30 mins long.
This may be the test that is mentioned in the Stew Peters video above.
h7XgtqTuvBvc
Inversion
8th July 2021, 15:09
I was listening to Coast to Coast AM last night. Earl Swift was on talking about the final three Apollo missions. A question came in about the composition of the moon dust. He said there was something like graphene that would cause the space suits problems. Perhaps there's a correlation with what's in the vaccines.
C2C (https://www.coasttocoastam.com/show/2021-07-07-show/)
sciencedaily (https://www.sciencedaily.com/releases/2008/09/080924191552.htm)
The trouble with moon dust stems from the strange properties of lunar soil. The powdery grey dirt is formed by micrometeorite impacts which pulverize local rocks into fine particles. The energy from these collisions melts the dirt into vapor that cools and condenses on soil particles, coating them in a glassy shell.
These particles can wreak havoc on space suits and other equipment. During the Apollo 17 mission, for example, crewmembers Harrison “Jack” Schmitt and Gene Cernan had trouble moving their arms during moonwalks because dust had gummed up the joints. “The dust was so abrasive that it actually wore through three layers of Kevlar-like material on Jack’s boot,”
onawah
8th July 2021, 18:24
GRAPHENE OXIDE IN JABS, MASKS AND SWABS
7/8/21
https://forbiddenknowledgetv.net/graphene-oxide-in-jabs-masks-and-swabs (https://forbiddenknowledgetv.net/graphene-oxide-in-jabs-masks-and-swabs/)
"Yesterday’s video with Dr Ruby on Stew Peters’ show has gone viral. A Serbian subscriber saw it and put me onto the source, a group in Spain called “La Quinta Columna” (“The 5th Column”), who put out this video by biostatistician, Ricardo Delgado. It is an excellent Spanish-language resource, along with Orwell.city, which did the English-language translation of this video (upon which I improved, slightly).
Delgado and his team of scientists have concluded that the symptoms of “COVID-19” are, in fact the symptoms of graphene oxide poisoning and that the graphene oxide nanoparticles discovered in the Pfizer vials by Dr. Pablo Campra Madrid at the University of Almería are also found in surgical masks, thus confirming of the suspicions of a British doctor, featured here last April. Surgical masks produced by Shandong Shenquan New Materials were taken off the market in Spain by the national health authority, Sanidad last April, due to the discovery of graphene oxide.
In addition, the 5th Column confirms other videos posted here last March, that graphene oxide is found in the testing swabs used in both the PCR and the antigen tests, as well as in all the flu shots after 2019.
In other words, everybody using Chinese surgical masks and taking COVID tests has been getting hit with graphene oxide – not just the vaccinated people!
This video also mentions that that NAC (N-acetyl cysteine), an antioxidant food supplement that is a precursor to glutathione, counters the toxic effects of graphene oxide and has also been shown to cure “COVID” in scientific studies.
Glutathione is found in very high levels in children. Therefore, “COVID” has hardly any impact on the child population. Glutathione levels drop considerably after 65 years of age, which is why “COVID” is more prevalent in older people.
Graphene oxide is particularly tuned to absorb electronic frequencies in the same bandwidth of the 5G network, which excites and oxidizes this material very rapidly. This has the effect of attacking our bodies’ natural antioxidant glutathione reserves.
Interestingly enough, Amazon just de-platformed – stopped selling – NAC! I saw Clif High tweet about that a week or two ago and he mentioned that his friend, who owns a supplement company still has some available.
TRANSLATED TRANSCRIPT
The Fifth Column is providing information that is vital to your health, physical integrity and of your environment.
The masks being used and currently marketed contain graphene oxide. Not only the ones that were withdrawn at the time, as indicated by the media, the testing swabs used in both PCR and antigen tests also contain graphene oxide nanoparticles.
All of the major COVID vaccines, AstraZeneca, Pfizer, Moderna, Sinovac, Janssen, Johnson & Johnson, etc. also contain a considerable dose of graphene oxide nanoparticles.
These findings are the result of analyses by electron microscopy and spectroscopy, among other techniques used at various public universities in Spain.
The anti-flu vaccine contains graphene oxide nanoparticles, as do the new anti-flu vaccines, as well as the new intranasal anti-COVID vaccines that they are soon to be released. All contain enormous doses of graphene oxide nanoparticles.
Graphene oxide is a poison that causes blood clots. Graphene oxide coagulates the blood. Graphene oxide alters the immune system by disrupting the oxidative balance in the body’s glutathione reserves.
If the dose of graphene oxide is increased by any route, it provokes immune system collapse. And subsequent cytokine storm.
Graphene oxide accumulates in the lungs and causes bilateral pneumonia by means of its uniform dissemination in the pulmonary alveolar tract.
Graphene oxide causes a metallic taste in the mouth. Perhaps this is starting to make sense to you.
Inhalation of graphene oxide causes inflammation of the mucous membranes and as a result, the loss of the sense of taste and partial or complete loss of the sense of smell.
Graphene oxide acquires powerful magnetic properties inside the body. This explains the magnetic phenomenon that millions of people around the world have already experienced, after various routes of administration of graphene oxide, of which the vaccine is but one.
In short, graphene oxide is the alleged SARS-CoV-2, the “novel coronavirus” that supposedly caused the disease known as COVID-19.
This is the real reason why we’ve never had real isolation and purification of the the novel coronavirus, which is a fact that is recognized at the highest levels of most health institutions in several countries when they were directly questioned about this.
COVID-19, the disease is the result of introducing graphene oxide by various routes of administration. Graphene oxide is extremely potent and strong in aerosols, as is the alleged SARS-CoV-2.
Like any material, graphene oxide has an “electronic absorption band”. This means that it absorbs a certain frequency that excites and oxidizes this material very rapidly, which attacks our bodies’ natural antioxidant glutathione reserves.
This frequency is in the bandwidths of the new 5G network. That is why the deployment of these towers never stopped during the pandemic. In fact, they were among the few services that were maintained, along with the heightened state security around them.
We suspect that during the 2019 anti-flu campaign, graphene oxide was introduced in these vials, since it was already being used as an adjuvant. With the subsequent 5G technology trials in different parts of the world, the COVID-19 disease developed in the interaction of the external electromagnetic fields and the graphene oxide now in their bodies.
Recall that it all started in Wuhan. This was the first pilot sample city in the world for the 5G technology trial in late November 2019. There’s a coincidence in space and time. Both the pangolin and bat soup episodes were used for distraction.
The purpose for the introduction of graphene oxide is even more obscure than you might imagine. Therefore, it is Moree than enough for you to assimilate this information and “reset” everything you thought you knew about the disease up to now.
From the highest governmental institutions telling the population to protect themselves and even forcing them to ingest something that could potentially make them sick with the very illness, itself.
Now that we know that the causative or etiological agent of the disease is actually a chemical poison and not a biological agent, we know how to attenuate it: By increasing glutathione levels.
Glutathione is a natural antioxidant present in reserves in the human body.
A few details will serve for you to fully understand everything that was poured into the media.
Glutathione is found in extremely high levels in children. Therefore, the disease has hardly any impact on the child population. Glutathione levels drop considerably after 65 years of age. This is why COVID-19 is more prevalent in the elder population. Glutathione levels are very high in the athletic population. This is why only .22% of athletes had the disease.
You will understand now why countless studies in practice have shown that treatment with N-acetyl cysteine (NAC), which is a precursor of glutathione or glutathione administered directly cured COVID-19 disease very quickly in patients, plain and simple because glutathione the levels were raised to cope with the administered toxicant called graphene oxide.
The discovery made here by the 5th Column suggests an ongoing full-scale attack of state bioterrorism – or at least with the complicity of governments – against the entire world population, constituting crimes against humanity.
It is therefore absolutely essential and vital that you make this information available to your medical community, physicians, nursing and health services in general, as well as local and regional media and press and those around you.
The 5th Column estimates that tens of thousands of people will die every day, in Spain alone when the government implements the switch to 5G technology.
Bearing in mind that it is not only the elderly in nursing homes who are vaccinated with that flu vaccine with graphene oxide but as you know, a large part of the population has been vaccinated – or “graphenated” with gradual doses of graphene oxide.
The body has a natural capacity to eliminate this toxin, which is why we suggest that you take up to one third of a dose per year during the next years, to keep the graphene in your bodies.
We have each and every one of the proofs of what has been described here and as long as the justice system isn’t working, people will continue to be pushed off a bottomless cliff. If you are watching this audiovisual material, you will understand that for more than a year, you have been totally and naïvely deceived by the highest institutions. Only now will you understand all of the inconsistencies that you have observed on your television news.
To complement this valuable information, you can access LaQuintaColumna.net or our Telegram channel La Quinta Columna TV, where over 100,000 are already aware of the truth and are not part of the mass deception. Please make this video go viral and let’s stop among all of us the destiny that awaits us, the fruit of the Agenda 2030 roadmap. It’s up to us. Thank you for your attention."
vgfzu7
thepainterdoug
8th July 2021, 22:00
Excellent. And I believe true. this explains why my gut has been turned upside down for over a year. my senses told me this is not what they say it is.
greybeard
9th July 2021, 05:41
UPDATE - GRAPHENE OXIDE POISON FOUND IN COVID SHOTS - MILLIONS INJURED AND DYING - ZOMBIE DOCTORS
https://www.bitchute.com/video/WVQkYdySGSAs/
Hundreds of thousands have been injured and just under a million lay dead from these poisonous covid Death Shots that everyone seems to be begging for.
Researchers have studied the contents of the PFIZER injection and found the contents to contain GRAPHENE OXIDE, a highly poisonous chemical.
They know what they are doing and it's simply called "MASS MURDER" or GENOCIDE.
If your doctor refuses to acknowledge this information, call him or her out to their face and find somebody else. They are nothing but ZOMBIE doctors just in it for the money and not your well being.
https://www.bitchute.com/video/wGhlIF4T1BjU/
BREAKING! AstraZeneca 'Vaccine' Vials Examined by Researchers Confirm TOXIC POISON
Not all vials are identical
Chris
Eric J (Viking)
9th July 2021, 06:16
Found this on my travels...
Bit too technical for me....
Are they saying that graphite is a good thing.
https://www.ncbi.nlm.nih.gov/pmc/articles/PMC7577689/
Viking
Bill Ryan
9th July 2021, 07:18
Dr Lee Merritt is asked about graphene oxide at 46:56 in this 7 July podcast. She's cautious, and summarizes the apparent situation (such as it is) for a couple of minutes. She says "it's something to watch", and that "it could be causing some of the problems".
My personal note: I'm cautious as well, and right now I can't buy the "99% graphene" claim. If so, there's no room for the engineered spike protein issue. One can't have this both ways!
jRVUxhAUge9X
So, this Tore Says show is very interesting if you are interested in the Graphene. You can probably skip the first half hour but she would seem to have a very good knowledge of biology and was digging into some of this stuff 10 years ago.
Unfortunately I was doing something else while listening so can't give a great breakdown.
However, she goes into the probability that Graphene is basically a neutral (depending on intent) bio hack. But that when combined with the ability of DNA to record everything (including intent/vibration which is explained in detail) and as part of a quantum system, could I suppose be used to gather data on an individuals integrity.
Now I know that probably sounds very unlikely to some, but it is a lose summary based on me half listening. The video is much less woo woo than my decription.
Interestingly the psychic Michelle Fielding also said the jabs contained a neutral substance that the Trump team could use to their advantage. I have included a link to a thread whose opening post contains the interview with her.
lGwgUQiQWU4
Michelle Fielding...
https://projectavalon.net/forum4/showthread.php?115403-The-white-hats-are-fully-in-control
Edit: and I should have explained that she was told that the element in the jab that was going to be used for evil, but that the white hats would now exploit it for good. And I think she also said that that was part of the reason for Trump's apparent promotion of it.
Gwin Ru
17th July 2021, 17:50
Doug Billings (https://dougbillings.us/our-videos/)
Exclusive: The Truth About Ingredients - Dangers of-the Jab 7-15-2021 Part 1 (https://dougbillings.us/video/exclusive-the-truth-about-ingredients-dangers-of-the-jab-7-15-2021/)
Exclusive: The Truth About Ingredients - Dangers of-the Jab 7-16-2021 Part 2 (https://dougbillings.us/video/exclusive-part-2-truth-about-ingredients-dangers-of-the-jab-7-16-2021/)
In Part 2, Karen Kingston produces a patent which lists graphene as a component of the injections.
Gwin Ru
17th July 2021, 20:39
...
... the riddle of the 99% of graphene oxide:
[...] a scientific report (https://z3news.com/w/graphene-oxide-the-actual-contents-inside-pfizer-vials-exposed/) that just came out from the University of Almería School of Engineering in Spain entitled,
“Graphene Oxide Detection in Aqueous Suspension: Observational Study in Optical and Electron Microscopy”,
where it was found that each dose of the Pfizer shot “was found to contain 6 ng of RNA and 747 ng of graphene oxide, which is 99.103% of the medication.
The patent dug up by Karen Kingston indicates that the graphene is used to built the spike protein as a "graphene lipid nano particle" (at 17:00 and 26:50 + 31:58 and 39:00 in the above Part 2 video).
... all that to eliminate "the human disease"... you know... like eliminate "the plague disease."
syrwong
18th July 2021, 17:10
Michel Chossudovsky interviews Ricardo Delgado, who was involved in the discovering of Grapene Oxide in the vaccines. Well presented and there is English interpretation.
https://www.globalresearch.ca/video-graphene-oxide-a-toxic-substance-in-the-vial-of-the-covid-19-mrna-vaccine/5750340
(I could not extract the video. Can the mods do it for me?)
thepainterdoug
18th July 2021, 17:22
EXCELLENT!! I have been in touch with La Quinta thru Orwell City. the site that translates for them will watch!!
Gwin Ru
18th July 2021, 18:04
Michel Chossudovsky interviews Ricardo Delgado, who was involved in the discovering of Grapene Oxide in the vaccines. Well presented and there is English interpretation.
https://www.globalresearch.ca/video-graphene-oxide-a-toxic-substance-in-the-vial-of-the-covid-19-mrna-vaccine/5750340
[...]
:clapping: :clapping: :clapping:
Here it is on Bitchute:
17S4PiXkfU6t
Bill Ryan
18th July 2021, 20:46
Michel Chossudovsky interviews Ricardo Delgado, who was involved in the discovering of Grapene Oxide in the vaccines. Well presented and there is English interpretation.
https://www.globalresearch.ca/video-graphene-oxide-a-toxic-substance-in-the-vial-of-the-covid-19-mrna-vaccine/5750340
[...]
:clapping: :clapping: :clapping:
Here it is on Bitchute:
17S4PiXkfU6t
Many thanks... here are some personal comments, if I may.
I don't understand this. :)
The symptoms of covid, whatever may be causing them, were present in many people (including forum members, see this thread: Did anyone seem to catch Covid-19 in October—December 2019? (https://projectavalon.net/forum4/showthread.php?110345-Did-anyone-seem-to-catch-Covid-19-in-October--December-2019)) long before vaccines started to be distributed.
The virus has been sequenced — many times. The smoking gun to suggest it was engineered in a lab as a bioweapon (albeit a weak one) is the anomaly at the Furin Cleavage Site, which is consistent with a small specialized component of HIV (which makes the virus better equipped to enter the cells) having been artificially spliced in there. None of this is addressed in this Spanish research.
If Chinese-made one-use medical masks were graphene-toxic, one would have expected their use to have been mandated at an early stage. But many people use cloth masks, and as best I know in every country those comply with all mask requirements.
The claimed very high percentage of graphene seems to preclude the presence of the mRNA-producing self-replicating spike protein factory. Many medics have argued, with good science behind them, that the spike proteins are the major long-term damaging factor that will compromise and weaken the natural components of one's immune system. We've already heard of autopsy reports in which the deceased person was overwhelmed by spike proteins. (Not graphene oxide!) As I've stated earlier, it seems to me that one can't have all this both ways.
NAC is recommended as a remedy, and this has been frequently stated earlier by others regardless of the seriousness or reality of the graphene problem. Below is an image of Chris Martenson's personal supplement list. Take NAC anyway! :)
https://projectavalon.net/Chris_Martenson_supplement_list.gif
DON'T GET 'VACCINATED. (Whatever the heck is in the shots.)
thepainterdoug
18th July 2021, 20:54
Bill
Good questions. I have been in touch with them at Orwell city for La Quinta . As you know, I already had the graphene oxide question confirmed by a" friend". Its a matter of how much and again, they would need to get their hands on all the vax samples for testing. im a little in fear for what will happen to these good people should they truly up root the agenda here.
I may write them back and ask your questions, no name of course. will keep you and all posted
Gwin Ru
18th July 2021, 22:10
[...]
Many thanks... here are some personal comments, if I may.
I don't understand this. :)
[...]
DON'T GET 'VACCINATED. (Whatever the heck is in the shots.)
I don't either :) However, what I understood is that the graphene is used as a component of the spike protein.
What is still a puzzle to me is how come HCQ and Ivermectin are efficient against whatever generates the blood clotting if it is the graphene alone?
The symptoms of covid, whatever may be causing them, were present in many people (including forum members, see this thread: Did anyone seem to catch Covid-19 in October—December 2019? (https://projectavalon.net/forum4/showthread.php?110345-Did-anyone-seem-to-catch-Covid-19-in-October--December-2019)) long before vaccines started to be distributed.There is the left field input that they were working on a vaccine when it "escaped" from a lab (Ft Detrick (https://projectavalon.net/forum4/showthread.php?113483-Predictions-for-2021&p=1440463&viewfull=1#post1440463)).
The virus has been sequenced — many times. The sequencing is computer generated... an actual, purified isolate is yet to show up, which is Dr. Mikovits beef about it.
So, whether spike protein or graphene, the end result is blood clotting and it can be made both ways when in some lots both of these ingredients combined together into one...
Since all this is experimental, one can imagine that some lots are of one kind, others are the other kind while others may still be unknown or plain placebo... to be sorted out by survivors...
syrwong
19th July 2021, 02:36
[...]
Many thanks... here are some personal comments, if I may.
I don't understand this. :)
[...]
DON'T GET 'VACCINATED. (Whatever the heck is in the shots.)
I don't either :) However, what I understood is that the graphene is used as a component of the spike protein.
What is still a puzzle to me is how come HCQ and Ivermectin are efficient against whatever generates the blood clotting if it is the graphene alone?
The symptoms of covid, whatever may be causing them, were present in many people (including forum members, see this thread: Did anyone seem to catch Covid-19 in October—December 2019? (https://projectavalon.net/forum4/showthread.php?110345-Did-anyone-seem-to-catch-Covid-19-in-October--December-2019)) long before vaccines started to be distributed.There is the left field input that they were working on a vaccine when it "escaped" from a lab (Ft Detrick (https://projectavalon.net/forum4/showthread.php?113483-Predictions-for-2021&p=1440463&viewfull=1#post1440463)).
The virus has been sequenced — many times. The sequencing is computer generated... an actual, purified isolate is yet to show up, which is Dr. Mikovits beef about it.
So, whether spike protein or graphene, the end result is blood clotting and it can be made both ways when in some lots both of these ingredients combined together into one...
Since all this is experimental, one can imagine that some lots are of one kind, others are the other kind while others may still be unknown or plain placebo... to be sorted out by survivors...
In conspiracy research, it is important to realize some seeming contradictions are not contradictions, as is illustrated in the blind men and the elephant story:
https://1.bp.blogspot.com/-vCPb9R7xXPo/WCMdYf1IjKI/AAAAAAAAAoQ/g-F-vowc6xQA1eE9eUyCzjkhbzX-zgxvQCEw/s1600/elephant-blind-men.jpg
Because of compartmentalization, even the scientists involved do not have the whole picture, how can we starting with just reports, some are fake, be able to get a whole consistent picture? I tend to believe the minority experts are telling the truth, and not dismiss one because of the belief in some others previously. Previous beliefs are usually much stronger. This is not scientific.
thepainterdoug
19th July 2021, 03:31
La Quinta now claims to find graphene oxide in VAXI GRIP flu shot from 2020 https://www.orwell.city/2021/07/graphene-oxide-found-in-vaxigrip-tetra-vaccination-vial.html
s7e6e
19th July 2021, 03:55
The sequencing is computer generated... an actual, purified isolate is yet to show up, which is Dr. Mikovits beef about it.
I am yet to see the picture of an actual "virus". Everything we see is computer generated. Cartoons for infantile.
46996
bluestflame
19th July 2021, 04:15
https://www.avensonline.org/wp-content/uploads/JIMT-2378-1343-02-0004.pdf
Why the Corruption of the World Health Organization (WHO) is the Biggest Threat to the World’s Public Health of Our Time
syrwong
19th July 2021, 04:19
The sequencing is computer generated... an actual, purified isolate is yet to show up, which is Dr. Mikovits beef about it.
I am yet to see the picture of an actual "virus". Everything we see is computer generated. Cartoons for infantile.
46996
No planes, no virus. A plane cannot do that much damage. A virus cannot too, however "novel" it is.
Bill Ryan
19th July 2021, 15:12
The sequencing is computer generated... an actual, purified isolate is yet to show up, which is Dr. Mikovits beef about it.
I am yet to see the picture of an actual "virus". Everything we see is computer generated. Cartoons for infantile.From https://www.niaid.nih.gov/news-events/novel-coronavirus-sarscov2-images (Feb 2020)
https://www.niaid.nih.gov/sites/default/files/styles/image_style_landscape_md/public/Vero-Covid-19-24h-hi_i034-rk.jpg?itok=mykCrOUw
This scanning electron microscope image shows SARS-CoV-2 (yellow)—also known as 2019-nCoV, the virus that causes COVID-19—isolated from a patient in the U.S., emerging from the surface of cells (blue/pink) cultured in the lab.
Gwin Ru
19th July 2021, 16:27
[...]
https://www.niaid.nih.gov/sites/default/files/styles/image_style_landscape_md/public/Vero-Covid-19-24h-hi_i034-rk.jpg?itok=mykCrOUw
This scanning electron microscope image shows SARS-CoV-2 (yellow)—also known as 2019-nCoV, the virus that causes COVID-19—isolated from a patient in the U.S., emerging from the surface of cells (blue/pink) cultured in the lab.... I am failing to see any "corona" or spikes/nails/stakes in there...
syrwong
19th July 2021, 16:28
The sequencing is computer generated... an actual, purified isolate is yet to show up, which is Dr. Mikovits beef about it.
I am yet to see the picture of an actual "virus". Everything we see is computer generated. Cartoons for infantile.From https://www.niaid.nih.gov/news-events/novel-coronavirus-sarscov2-images (Feb 2020)
https://www.niaid.nih.gov/sites/default/files/styles/image_style_landscape_md/public/Vero-Covid-19-24h-hi_i034-rk.jpg?itok=mykCrOUw
This scanning electron microscope image shows SARS-CoV-2 (yellow)—also known as 2019-nCoV, the virus that causes COVID-19—isolated from a patient in the U.S., emerging from the surface of cells (blue/pink) cultured in the lab.
The picture/photograph look fine, but it generates many questions.
1. Why are there so few pictures of the virus under the electronic microscope?
2. such a photo should come in a pair, one with much greater magnification, showing the spikes
3. Each variant deserves a selfie. Why aren't there phots of the variants? There should be an outward difference between the so-called variant, maybe the number of spikes is different? If they look exactly the same, even a retarded immune system can identify them, just by their look.:bigsmile:
From Bill:
niaid.nih.gov (https://www.niaid.nih.gov/news-events/novel-coronavirus-sarscov2-images) link fixed, my apologies.
Bill Ryan
19th July 2021, 16:36
[...]
https://www.niaid.nih.gov/sites/default/files/styles/image_style_landscape_md/public/Vero-Covid-19-24h-hi_i034-rk.jpg?itok=mykCrOUw
This scanning electron microscope image shows SARS-CoV-2 (yellow)—also known as 2019-nCoV, the virus that causes COVID-19—isolated from a patient in the U.S., emerging from the surface of cells (blue/pink) cultured in the lab.... I am failing to see any "corona" or spikes/nails/stakes in there...~~~
Here's another image, dated a few weeks later. (3 March 2020)
https://www.nih.gov/news-events/nih-research-matters/novel-coronavirus-structure-reveals-targets-vaccines-treatments
https://www.nih.gov/sites/default/files/styles/floated_media_breakpoint-medium/public/news-events/research-matters/2020/20200303-conv.jpg?itok=hfXA-Fdr×tamp=1583244144
Transmission electron microscope image shows SARS-CoV-2, the virus that causes COVID-19, isolated from a patient in the U.S. Virus particles are emerging from the surface of cells cultured in the lab. The spikes on the outer edge of the virus particles give coronaviruses their name, crown-like.
Gwin Ru
19th July 2021, 18:30
[...]~~~
Here's another image, dated a few weeks later. (3 March 2020)
https://www.nih.gov/news-events/nih-research-matters/novel-coronavirus-structure-reveals-targets-vaccines-treatments
https://www.nih.gov/sites/default/files/styles/floated_media_breakpoint-medium/public/news-events/research-matters/2020/20200303-conv.jpg?itok=hfXA-Fdr×tamp=1583244144
Transmission electron microscope image shows SARS-CoV-2, the virus that causes COVID-19, isolated from a patient in the U.S. Virus particles are emerging from the surface of cells cultured in the lab. The spikes on the outer edge of the virus particles give coronaviruses their name, crown-like.Thanks Bill, I still am 1/2 convinced not only because of mistrust of what comes out of the NIH/NIAID but there is no scale in these micrographs to compare the size of the critters... very unscientific/unprofessional.
Then, I have to trust their word that it's not the run of the mill common cold virus:
https://upload.wikimedia.org/wikipedia/commons/thumb/7/78/Coronaviruses_004_lores.jpg/220px-Coronaviruses_004_lores.jpg
Coronaviruses (https://en.wikipedia.org/wiki/Coronavirus) are a group of viruses known for causing the common cold. They have a halo or crown-like (corona) appearance when viewed under an electron microscope.
or some flu virus:
Influenza A virus:
https://upload.wikimedia.org/wikipedia/commons/thumb/0/00/Viruses-12-00504-g001.webp/220px-Viruses-12-00504-g001.webp.png (https://en.wikipedia.org/wiki/File:Viruses-12-00504-g001.webp)
Structure of influenza A virus
https://upload.wikimedia.org/wikipedia/commons/thumb/7/7f/Influenza_A_-_late_passage.jpg/220px-Influenza_A_-_late_passage.jpg (https://en.wikipedia.org/wiki/File:Influenza_A_-_late_passage.jpg)
TEM (https://en.wikipedia.org/wiki/Transmission_electron_micrograph) micrograph of influenza A viruses
Influenza B virus
Influenza B virus
https://upload.wikimedia.org/wikipedia/commons/thumb/a/ae/Ijms-18-00020-g001.B.png/220px-Ijms-18-00020-g001.B.png (https://en.wikipedia.org/wiki/File:Ijms-18-00020-g001.B.png)
Virion structure of influenza B virus
Virus classification (https://en.wikipedia.org/wiki/Virus_classification) https://upload.wikimedia.org/wikipedia/commons/7/74/Red_Pencil_Icon.png (https://en.wikipedia.org/wiki/Template:Taxonomy/Betainfluenzavirus)
Virus (https://en.wikipedia.org/wiki/Virus)
Riboviria (https://en.wikipedia.org/wiki/Riboviria)
Riboviria:
https://upload.wikimedia.org/wikipedia/commons/thumb/d/da/Riboviria_collage.png/220px-Riboviria_collage.png (https://en.wikipedia.org/wiki/File:Riboviria_collage.png)
Clockwise from top left: TEM (https://en.wikipedia.org/wiki/Transmission_electron_microscopy) of avian coronavirus (https://en.wikipedia.org/wiki/Avian_coronavirus), polio virus (https://en.wikipedia.org/wiki/Polio_virus), bacteriophage Qβ (https://en.wikipedia.org/wiki/Bacteriophage_Q%CE%B2), ebolavirus (https://en.wikipedia.org/wiki/Ebolavirus), tobacco mosaic virus (https://en.wikipedia.org/wiki/Tobacco_mosaic_virus), influenzavirus A (https://en.wikipedia.org/wiki/Influenzavirus_A), rotavirus (https://en.wikipedia.org/wiki/Rotavirus), HIV-1 (https://en.wikipedia.org/wiki/HIV-1). Center: homologous (https://en.wikipedia.org/wiki/Homology_(biology)) RT (https://en.wikipedia.org/wiki/Reverse_transcriptase) and RdRps (https://en.wikipedia.org/wiki/RNA-dependent_RNA_polymerase) with conserved palm domain.
Then, there is the CDC which keeps repeating they don't have any SARS-Cov2 to submit to independent studies.
s7e6e
20th July 2021, 03:24
Thank you Ryan but here are my thoughts, if I may:
The whole world has been brought to its knees by this "virus" (which most likely is just extreme EM radiation exposure + depop shots) but apparently this microscopic threat is so elusive, we only have 1 set of pictures from 1 entity. An entity imbued in mistrust and deceit.
Let me state that again. We have HUNDREDS of MILLIONS of "infected" people, and TENS of BILLIONS of dollars invested in "curing" these people, yet we only get 1 set of misleading pictures, lacking scientific consistency.
It's like searching for a picture of Earth from space. We only get "mosaics", "compositions", "renderings" or "artist's impression" in fine print.
Gwin Ru
20th July 2021, 15:34
Graphene-based “neuromodulation” technology is REAL: Press release from INBRAIN Neuroelectronics describes brain controlling biocircuits using AI-powered graphene (https://www.naturalnews.com/2021-07-19-graphene-based-neuromodulation-technology-is-real-inbrain-neuroelectronics.html)
by: Mike Adams (https://www.naturalnews.com/author/healthranger)
Monday, July 19, 2021
https://www.naturalnews.com/wp-content/uploads/sites/91/2021/07/Neurons-Nervous-System-2.jpg
(Natural News (https://www.naturalnews.com)) With an increasing number of people becoming aware of graphene oxide being identified in covid vaccines, a company called INBRAIN Neuroelectronics demonstrates that graphene-based “neuromodulation” technology using AI-powered neuroelectronics is very real.
A March 30th, 2021 press release published by BusinessWire.com (https://www.businesswire.com/news/home/20210330005388/en/INBRAIN-Neuroelectronics-Secures-17-Million-in-Series-A-Funding-for-First-AI-Powered-Graphene-Brain-Interface) reveals the story:
INBRAIN Neuroelectronics Secures $17 Million in Series A Funding for First AI-Powered Graphene-Brain Interface
Funding enables company to advance first-in-human studies for its flagship product, a less-invasive neuromodulation device for treating neurological conditions using artificial intelligence and graphene electrodes
To be clear, we are not in any way claiming that INBRAIN is involved in covid vaccines. Rather, they state their technology is being used, “for treating epilepsy and Parkinson’s disease.” The point of covering INBRAIN is to reveal that brain-controlling “biocircuits” based on graphene are, in fact, a very real technology.
So-called “fact-checkers” — which are nothing more than disinformation propaganda pushers — routinely claim that graphene isn’t found in vaccines and that graphene biocircuits are a conspiracy theory. INBRAIN Neuroelectronics shows that the fact checkers are lying.
In fact, as INBRAIN says in their own press release, they are, “aiming to establish the safety of graphene as the new standard of care for neurotechnology devices.”
They also describe graphene biocircuits as a kind of platform that can be upgraded:
Less invasive and more intelligent neuroelectronic technologies like ours could provide safer therapies that are upgradable and adaptive in real time…
If that sounds familiar, it’s probably because Moderna, creator of the mRNA covid vaccine, has described its technology as an “operating system” that can be updated and reprogrammed at any time, also.
At the INBRAIN Neuroelectronics website (https://www.inbrain-neuroelectronics.com), the company describes itself thusly:
We are scientists, doctors, techies and humanity lovers, with the mission of building neuroelectronic interfaces to cure brain disorders. We use GRAPHENE, the thinnest material known to man to build the new generation of neural interfaces for brain restoration to help patients around the world.
It also quites Prof. A. Fasano, saying, “Graphene is the next big thing in bioengineering materials, which are pillar components to the next gen of electrotherapies in the steadily growing field of neuromodulation.”
The company highlights its technology as being able to “read” a person’s brain, detect specific neurological patterns, and then control that person’s neurology to alter their brain function. In their own words:
Our graphene-brain interfaces have the capability of reading at a resolution never seen before, as well as detecting therapy-specific biomarkers and triggering highly focal adaptive neuromodulation for increased outcomes in personalised neurological therapies.
Graphene is further described as, “Thinnest known material to perfectly adapt stimulation to targeted brain anatomy.”
Anyone saying that graphene isn’t being used to control human neurology is either wildly ignorant of the state of modern neuroscience or is deliberately lying to you.
To clarify yet again, we are not stating that INBRAIN Neuroelectronics is engaged in any sort of nefarious agenda, nor that they are involved in covid vaccines. As with every technology, graphene-based biocircuits can be used for both good or evil, depending on the ethics and motivations of those who control the technology. There are no doubt very positive applications for this tech, but as with most technologies that were once touted as empowering humanity — television, vaccines, the internet, nuclear power, robotics, etc. — they all end up in the hands of lunatic, genocidal globalists who wield them as weapons against humanity.
In other words, there is no technology that madmen won’t exploit to enslave humanity and increase their own power and control. Graphene biocircuits give power-hungry lunatics direct access to your brain, and according to many analysts (see below), vaccines provide the excuse to inject human victims with graphene-based substances that self-assemble into biocircuits in the human brain.
CLAIM: Covid vaccines contain high levels of graphene oxide, which is self-assembled into biocircuits by harvesting elements (such as iron) from human blood
As reported by Orwell.city (https://www.orwell.city/2021/07/graphene-oxide.html), a group called La Quinta Columna has analyzed covid vaccines and has found that 98% to 99% of the non-liquid mass in the vaccine appears to be graphene oxide. Ricardo Delgado, speaking for La Quinta Columna, says:
A phenomenon that for a long time was denied, but today has been already proved. There are millions of videos of people going around the world. Videos about this phenomenon of, let’s call it ‘pseudo-magnetism acquired after inoculation’, but it can also be acquired through other ways. So, once we conducted that basic epidemiological study, we started to wonder what materials or nanomaterials can cause magnetism in the body. And not only magnetism, but that could act as energy capacitors, because I have also measured in a multimeter an important charge…
This is a phenomenon of electromagnetic induction in the metal that adheres near the inoculation area. In addition, we have found that the magnetism then moves towards the head. And this is very important. Surely for the purpose they may seek. In addition, a potential difference is measured with a multimeter: the person becomes a superconductor. That is, it emits and receives signals. And when we found the materials that can cause this type of alterations in the body, we began to talk about graphene. We suspected it was graphene oxide since it had all the characteristics that magnetized people expressed after inoculation.
Graphene is toxic, it is a chemical, a toxic chemical agent. Introduced in the organism in large quantities, it causes thrombi. It causes blood clots. We have all the scientific articles to back it up. It causes post inflammatory syndrome, it causes alteration of the immune system. And when the redox balance is broken, in the sense that there is less of the body’s own reserve glutathione than an introduced toxicant such as graphene oxide, it generates a collapse of the immune system and a cytokine storm. In other words, something very similar to the fashionable disease, isn’t it?
See the video here:
Brighteon.com/eaff4c87-eb1d-4abd-9f6e-6edeebe6fe59 (http://Brighteon.com/eaff4c87-eb1d-4abd-9f6e-6edeebe6fe59)
Delgado goes on to state:
And given that all the people who are inoculated with the Pfizer vaccine, which was the one we sent for analysis, as well as Moderna, AstraZeneca, Johnson&Johnson, Janssen, Sinovac, and all types of vaccines acquire magnetic properties, we suspect with many indications that they all contain more or less doses of graphene, of graphene oxide.
…we know that precisely N-acetylcysteine or glutathione itself degrades graphene oxide. That is why we think that we probably hit directly on the causative or etiological agent of the disease.
In today’s Situation Update podcast (https://www.brighteon.com/378b3154-6cb8-4a59-97f1-ffbfe25d863e), I cover more details of this exotic nanotechnology, including “self-assembling” graphene biocircuit nanostructures, and how these may be building an antenna to receive commands or instructions from external electromagnetic fields.
If this is what’s happening, it means global governments might be able to control the vaccinated masses by broadcasting signals from 5G cell towers. Although it sounds like science fiction, this technology has already been proven in experiments with mice, involving both SPIONs (Super Paramagnetic Iron Oxide Nanoparticles) for targeted tissue drug delivery (https://www.ncbi.nlm.nih.gov/pmc/articles/PMC4167583/) as well as “magneto” proteins that achieve neuromodulation (https://www.theguardian.com/science/neurophilosophy/2016/mar/24/magneto-remotely-controls-brain-and-behaviour) (brain control).
Gwin Ru
22nd July 2021, 14:59
The Right Side with Doug Billings - July 21, 2021 (https://rumble.com/vk5gfj-the-right-side-with-doug-billings-july-21-2021.html)
The Right Side with Doug Billings & guest Karen Kingston (https://rumble.com/c/DougBillings) 1:00:00
Published July 21, 2021
vhjaa9
Rumble (https://rumble.com/) — Doug continues his conversation with Karen Kingston: Rand Paul - Fauci, graphene in the encapsulating lipid (PEGylated Lipid Nanoparticle "excipients") making the mRNA stable, transmission, etc...
Gwin Ru
23rd July 2021, 13:37
How Long Do the Vaccinated Have to Live? (https://henrymakow.com/2021/07/how-long-do-vaccinated-have-to.html)
by Steven Fishman
(henrymakow.com)
July 22, 2021
https://henrymakow.com/upload_images/how-long.jpg
Dr. Mylo Canderian is of the opinion that 95% of the world's population are "Useless Eaters" who need to be euthanized as quickly as possible.
The answer to the question: three to ten years
Disclaimer- I don't know if this is true but, in the past, Steven Fishman has provided credible insider information.
END OF CYCLE FORMULA FOR THE 'VACCINATED'
by Steven Fishman
(henrymakow.com)
I am often asked the question: "If I have taken the "vaccine," how long will I live?
I deferred this question to a friend of mine, Dr. Mylo Canderian, Ph.D. , who developed the patent for Graphene Oxide for use as a Hematological Bioweapon in 2015.
https://henrymakow.com/upload_images/atali-quote.jpg
In full transparency, Dr. Canderian is what I would call a "Genocidal Globalist," who follows Precept Ten of the Georgia Guidestones, which is very seldom discussed, stating "Be not a Cancer upon the Earth; Leave Room for Nature."
Dr. Canderian is a Medical Contributor to the World Health Organization and is also very supportive of Klaus Schwab and the "Great Reset," ushering in one world digital currency which is a secondary goal of the WHO for 2022.
Dr. Canderian is of the opinion that 95% of the world's population are "Useless Eaters" who need to be euthanized as quickly as possible.
"Look at downtown Chicago, Baltimore, or Los Angeles," he has stated, "and you will clearly see why the Useless Eaters must be put down like rabid dogs."
He has expressed his disdain for "Infectious Educators" who promote Critical Race Theory, and is confident that the "vaccine" will put an end to "Human Cancer Upon the Earth."
Dr. Canderian is an ardent supporter of Freemasonry's Duty and Obligation to rid the world of the "Plague of Humanity."
Yet on a personal level, he and I share a passion for the same exotic dish served at L'emince de Veau in Geneva: Cream of Hummingbird Soup followed by Elk Tongue.
We both are fans of Chef Gaston Sere de Rivieres, who is a culinary genius.
So, I asked Mylo, "How can the "vaccinated" know with certainty how long they have to live once they have been jabbed?"
He presented me with the information, called the "End of Cycle Formula."
He explained how easy it is to calculate.
"The Power of Simplicity," he said. "There is a maximum cycle of ten years from injection to End of Cycle," [or death], he elaborated. "And it is extremely easy to determine."
He said any hematologist can see it within seconds under a microscope, and even more readily under an electron microscope. "The percentage of blood affected [or contaminated] by or with Graphene Oxide is the reciprocity of the End of Cycle calculation," he divulged.
In other words, an "inoculatee" [as he calls anyone jabbed with the Experimental Use Authorization Eugenics Depopulation Lethal Injection Bioweapon] having 20% Graphene Oxide deterioration in their blood will, barring any other input criteria, live for 8 years. [10 years less 20%].
Someone with 70% Graphene Oxide deterioration will not live more than 3 years. [10 years less 70%].
https://henrymakow.com/upload_images/ruby-peters.jpg
Dr. Jane Ruby recently was interviewed by Stew Peters on his podcast (https://www.bitchute.com/video/gSEUkG0AB8J5/) and showed examples of what the deteriorated blood looks like when exposed to Graphene Oxide.
Graphene Oxide, for those who are unaware, is the component of Messenger RNA spike proteins and prions, which is at war with the heart, lungs, brain and blood for oxygen.
Graphene Oxide is an oxygen sponge which deprives the body of necessary oxygen and causes many complications, including but not limited to anaphylactic shock, toxic blood clotting, fatal lung paralysis, mitochondrial cancer, and endothelial cancer."
Dr. Mylo Canderian's viewpoint is much the same as Klaus Schwab, Bill Gates, and the Big Pharma CEO's: LET THEM ALL DIE!
I asked Mylo what the effect of second and third shots and boosters do and how that changes the End of Cycle table.
Mylo replied: "It is all measurable through hematological testing. The more shots and boosters the imbeciles get, the worse their blood will look under a microscope, and the quicker they will turn to fertilizer."
Finally, I asked him how the plot to kill so many billions of people could be kept so secret by such a group of elites.
His answer was: "You don't know much about Freemasonry, do you, Steve?" And there you have it.
-----------------
Related:
Do Gullible People Deserve to Die? (https://rumble.com/vj5m95-covid-vaccine-horror-stories-these-people-speak-out-and-share-their-reactio.html) Video
Archbishop Vigano Says Vaccines are Human Sacrifice of Innocent Victims to Satan (https://www.trunews.com/stream/archbishop-vigano-says-vaccines-are-human-sacrifice-of-innocent-victims-to-satan)
Heartbreaking Accounts of Adverse Reactions (https://www.c19vaxreactions.com/real-testimonials.html) - Satanists feast on human suffering
More suffering souls for Satan (https://www.medscape.com/sites/public/covid-19/vaccine-insights/how-concerned-are-you-about-vaccine-related-adverse-events?src=soc_fb_share&fbclid=IwAR0mmHOgEpAmKHb4t5O2Tdmf8RRuI7-KIiaVxgTPpP5ruvg63N3buaqgjnE)
https://projectavalon.net/forum4/showthread.php?113668-Vaccination-Injuries-On-Record-for-Covid19&p=1441692&viewfull=1#post1441692
First Comment from DM:
[B]"Dr. Mylo Canderian, Ph.D. [born Milos Iskanderianos, Corfu, Greece, 1938], who developed the patent for Graphene Oxide for use as a Hematological Bioweapon in 2015."
Despite that some facts mentioned in the article above could sound true. It takes less than 3 minutes to realize that this doctor doesn't exist. Patents available using graphene oxide available on the internet are mostly developed by korean and chinese researchers. Here an article in Alerta Digital with links directed to several sites where these patents are recorded. (https://www.alertadigital.com/2021/07/17/las-patentes-de-oxido-de-grafeno-en-vacunas-covid-existen-y-son-reales/?fbclid=IwAR09g-JWM4qGOFsyRxrGRdwLA9sRT-sjHFgXJqTzZiSnJVTqCwyECEdmlzg)
Besides is possible to remove graphene oxide nanoparticles out of the human body by increasing glutathione levels by using N Acetylcysteine and Zinc supplements. (that's why they want to innoculate us as many times as possible!)
Steven Fishman replies:
As far as I know, it is not possible to remove Graphene Oxide from the blood using NAC or Zinc but I will ask Dr. Jane Ruby. I do not know where Mylo's patents were filed, but he has told me that the World Health Organization has them. I will research it further, but I can assure you that when I worked for Norah Cali at the Progress for Peace Foundation, our interactions with Mylo were consistent. As I said, I have met him in Davos, Switzerland.
Bill Ryan
23rd July 2021, 16:53
How Long Do the Vaccinated Have to Live? (https://henrymakow.com/2021/07/how-long-do-vaccinated-have-to.html)
A comment which I felt obliged to make. If this is all true (and of course it may be) — then this report could not be more important.
Gwin Ru
23rd July 2021, 23:34
How Long Do the Vaccinated Have to Live? (https://henrymakow.com/2021/07/how-long-do-vaccinated-have-to.html)
A comment which I felt obliged to make. If this is all true (and of course it may be) — then this report could not be more important.Well... there might be something to it:
1417946678016061440
Although someone may have misread something... in any case there is a mismatch of numbers since it would be 34 M bags:
1418025188520833028
1418184703392288772
Gwin Ru
27th July 2021, 12:17
...
... lifted from another thread:
See how the Graphene links up? This would be similar to clotting in the bloodstream. This would cause heart attacks, blood clots and strokes. This is why this will be used in conjunction with 5G to cause illness and death.
Source: ORWELL CITY
More information:
https://www.orwell.city/2021/07/graphene-and-electromagnetic-discharges.html
Graphene tends to organize itself, creating a grid when exposed to EMF.
Let's remember that La Quinta Columna has already warned us about the toxicity of this nanomaterial that had been silently introduced into the population through physiological saline, vaccines, masks, PCR tests, and other administration routes under investigation.
The following video serves as an example, so you can speculate what it does once into the body.
JDWsHqRQW2yL
Gwin Ru
27th July 2021, 17:50
...
... since the above might be ball bearings simulating graphene oxide behaviour, this one might be closer to reality:
Graphene Reacting To EM Field From A Cell Phone - This Is In The Covid Vax and in peoples blood (https://www.bitchute.com/video/KwKugDCb5vfb/) 01:48
Watch (https://www.bitchute.com/video/KwKugDCb5vfb/#video-watch)
First published at 16:48 UTC on July 27th, 2021.
Jim_Crenshaw (https://www.bitchute.com/channel/jim_crenshaw/)
Jim_Crenshaw (https://www.bitchute.com/profile/GZUdqgkWiFEM/)
The so-called "Covid-Vaccine" was found to be 99% Graphene Oxide, which is known to be able to pass through the blood/brain barrier. These nanobots very well may be a new life form, and now they're swimming around inside the heads of the idiots that volunteered to get the Covid-Kill-Shot... What could possibly go wrong?
Source: SonOfEnosh (https://www.bitchute.com/channel/sonofenosh/)
KwKugDCb5vfb
thepainterdoug
27th July 2021, 18:19
The latest from La Quninta on the Graphene oxide:
https://orwell.city/2021/07/tunable-electrical-conductivity-of-graphene.html
La Quinta Columna on the Tunable Electrical Conductivity of Graphene
July 27, 2021
As the duo of researchers from La Quinta Columna usually does in all their programs, they once again read and discussed papers on graphene.
They're still looking for a study on how graphene behaves when exposed to EMF fields in vivo, the only one they need to confirm all their lucubrations about the role of this nanomaterial in neuro-control. However, every study they find in their search is worthwhile, and today's was no exception.
Dr. José Luis Sevillano shared some very interesting conclusions regarding the paper entitled: 'Porous Graphene Micro flowers for High-Performance Microwave Absorption', which describes, among other things, the tunable electrical conductive property of graphene.
At the foot of the article is the excerpt selected by Orwell City.
Ricardo Delgado: One more article discussing abosorption is this one on Porous graphene microflowers for microwave absorption.
It says: Porous Graphene Microflowers for High-Performance Microwave Absorption. Microwave means mobile telephony here, just so you guys understand.
"Graphene has shown great potential in microwave absorption (MA) owing to its high surface area, low density, tunable electrical conductivity and good chemical stability. To fully realize grapheneʼs MA ability, the microstructure of graphene should be carefully addressed. Here we prepared graphene microflowers (Gmfs) with highly porous structure for high-performance MA filler material. The efficient absorption bandwidth (reflection loss ≤ −10 dB) reaches 5.59 GHz —It's in the 5G bandwidth, isn't it?— and the minimum reflection loss is up to −42.9 dB, showing significant increment compared with stacked graphene."
In other words, depending on the three-dimensional structure given to the graphene, it has one absorption band or another. That's what we're seeing.
"Besides, the low filling content and low density are beneficial for the practical applications. Without compounding with magnetic materials or conductive polymers, Gmfs show outstanding MA performance with the aid of rational microstructure design.
Furthermore, Gmfs exhibit advantages in facile processibility and large-scale production compared with other porous graphene materials including aerogels and foams."
Well, and here is the study below. Here you can read it in full.
Dr. José Luis Sevillano: And you've already noticed, huh? 'Tunable electrical conductivity.'
So, depending on the wave signal, it becomes more or less conductive. Therefore, you can perfectly have it in your body.
If you don't expose it to waves that you shouldn't, graphene doesn't conduct or hardly conducts at all. But whenever you want, you expose it to those waves, and it goes crazy. It starts to be more and more conductive. It means that it starts to oxidize. That's almost for sure. Automatically. It means that it starts to destroy. It means that its conductive capabilities can be tuned. It means that it can do damage or not, as you wish.
They're the ones saying so. Not us.
Do you think you can help La Quinta Columna find the missing paper they need? Do you want to get in touch with them? Then you can refer to their official website and follow them on their official channels on Telegram, Instagram, Youtube and Twitch. If you want to contact directly, send them a message to: tutoronline@hotmail.es. Don't worry about the language barrier, they understand English and French.
Remember that Orwell City is not affiliated with La Quinta Columna. This is a website dedicated to gathering important information that this team of researchers delivers (and also from the many others from the Spanish-speaking world who are doing a great job in unmasking the plandemic).
Orwell City summarizes, transcribes, translates, edits and subtitules videos so that everyone can learn about the shocking discovery they have made about the true content of the vaccination vials.
Follow Orwell City on Telegram. Thank you for reading!
https://rumble.com/vkdmcz-la-quinta-columna-on-the-tunable-electrical-conductivity-of-graphene.html
vhrg7p
—Orwellito.
ExomatrixTV
27th July 2021, 20:27
This Is How Graphene Reacts When Exposed To 5G Electromagnetic Fields (EMFs):
JDWsHqRQW2yL
source (https://www.bitchute.com/video/JDWsHqRQW2yL/)
I wonder if there are still people in our midst who think that: "worrying about 5G (https://projectavalon.net/forum4/showthread.php?100537-Stop-5G-before-it-s-irreversible-) (Military Grade Beam-forming Technology that CAN be Weaponized!) is just "Fear Porn (https://projectavalon.net/forum4/tags.php?tag=5g+fear+porn)" as some one added that as a "tag" to this Project Avalon Forum Thread (https://projectavalon.net/forum4/showthread.php?100537-Stop-5G-before-it-s-irreversible-)!
Delight
27th July 2021, 21:55
Not sure the claims are true but as you said... important if true.
How Long Do the Vaccinated Have to Live? (https://henrymakow.com/2021/07/how-long-do-vaccinated-have-to.html)
A comment which I felt obliged to make. If this is all true (and of course it may be) — then this report could not be more important.
How Long Do the Vaccinated Have to Live?
by Dr. Raymond Oenbrink | CIRS, Functional & Integrative Medicine, ISEAI, Neurodegeneration & Brain Health (https://appwell.net/how-long-do-the-vaccinated-have-to-live/)
How Long Do the Vaccinated Have to Live?
Table of Contents [show]
Steven Fishman was the author of the article published on 7/22/21.
Per the article made egregious claims about the following, stating he had engineered the toxicity of adding graphene and/or graphene oxide to the current “Covid Shot”–no other, independent evidence available online supports his assertion.
Dr. Mylo Canderian PhD Patent Specialist, Licensing, Technologist, Santa Barbara, California, United States
Mr. Fishman is also a known convicted felon, having been involved in legal battles and spending time in prison due to his history with the Church of Scientology. At one point he was sentenced to prison until October 28, 2028. He was released early however.
Prior to 7/22/24 an online search wasn’t able to reveal much of anything to do with Mr. Fishman, Dr. Mylo Canderian, Ph.D. or the name he as allegedly born with; Milos Iskanderianos of Corfu, Greece, in 1938.
The 7/22/21 article makes many sensational claims;
1. Dr. Canderian is what I would call a “Genocidal Globalist,”.
2. Follows Precept Ten of the Georgia Guidestones, which is very seldom discussed, stating “Be not a Cancer upon the Earth; Leave Room for Nature.”
3. Dr. Canderian is a Medical Contributor to the World Health Organization and is also very supportive of Klaus Schwab and the “Great Reset,” ushering in one world digital currency which is a secondary goal of the WHO for 2022.
4. Dr. Canderian is of the opinion that 95% of the world’s population are “Useless Eaters” who need to be euthanized as quickly as possible.
5. Dr. Canderian is an ardent supporter of Freemasonry’s Duty and Obligation to rid the world of the “Plague of Humanity.”
6. He presented the “End of Cycle Formula.”
7. “The Power of Simplicity,” he said. “There is a maximum cycle of ten years from injection to End of Cycle,” [or death], he elaborated. “And it is extremely easy to determine.”
8. Any hematologist can see it within seconds under a microscope, and even more readily under an electron microscope. “The percentage of blood affected [or contaminated] by or with Graphene Oxide is the reciprocity of the End of Cycle calculation,” he divulged.
9. An “inoculatee” [as he calls anyone jabbed with the Experimental Use Authorization Eugenics Depopulation Lethal Injection Bioweapon] having 20% Graphene Oxide deterioration in their blood will, barring any other input criteria, live for 8 years. [10 years less 20%].
10. Someone with 70% Graphene Oxide deterioration will not live more than 3 years. [10 years less 70%].
11. Dr. Jane Ruby recently was interviewed by Stew Peters on his podcast and showed examples of what the deteriorated blood looks like when exposed to Graphene Oxide. These pictures could not be independently reproduced on a review of the online literature & images.
12. Graphene Oxide, for those who are unaware, is the component of Messenger RNA spike proteins and prions, which is at war with the heart, lungs, brain and blood for oxygen.
13. Graphene Oxide is an oxygen sponge which deprives the body of necessary oxygen and causes many complications, including but not limited to anaphylactic shock, toxic blood clotting, fatal lung paralysis, mitochondrial cancer, and endothelial cancer.”
14. “Dr. Mylo Canderian’s viewpoint is much the same as Klaus Schwab, Bill Gates, and the Big Pharma CEO’s: LET THEM ALL DIE!”
Graphene & Graphene Oxide have Complex Toxicity Traits
Concentration of the graphene
Reduction/Oxidation state of Graphene & Graphene Oxide
Size of the graphene polymer (group of repeating subunits, or monomers create a polymer).
Shape the polymer assumes
Surface chemistry fo the cells that it interacts with.
Duration of contact.
The biological milieu.
Type of organism; Procaryotic bacteria, Eucaryotic higher order cells such as mammalian, viral
In-vivo (within an organism) or In-vitro (laboratory) settings.
Graphene Efffects on Mammalian Cells are Numerous via many Pathways;
Toxic Response Mechanisms
Cytotoxicity
DNA damage
Oxidative stress
Reactive Oxygen Species (ROS)
NADPH oxidase dependent ROS
High deregulation of antioxidant/DNA repair/apoptosis related genes, conversely
Poor gene regulation
Global gene expression
Transforming growth factor beta 1 (TGFβ1) mediated signaling
Toll like receptors- Nuclear Factor Kappa
Beta (TLR4-NFκB)
Limitation of nutrient availability
Various amino acids or biological molecules were adsorbed onto the surface of the graphene which may affects the cellular viability [42, 43].
Cytotoxic effects of GO towards human fibroblast cell (HDF)
Lysosomes
Mitochondria
Endoplasm.
The amount of intracellular uptake increases with the increasing dose and exposure time.
Apoptosis; programmed cell death regulation
Mitochondrial membrane depolarization (necessary for ATP/energy generation).
Hemolysis (rupture of blood cells).
Blood clotting/thrombosis (also seen with COVID
Inflammatory cytokines release
Even at sub-cytotoxic concentration (20µg/ml) graphene has been reported to induce macrophages cell death by triggering
Mitogen Activated Protein (MAP) kinase and
Tranforming Growth Factor (TGF) pathways.
It also induces the release of several cytokines and chemokines by activating
NFκB &
Toll-Like Receptor (TLR) mediated pathways.
Macrophages treated with graphene enhance the expression and
secretion of proinflammatory cytokines.
Th1/Th2 cytokines such as IL-1α, IL-6, IL-10, TNFα
and
GM-CSF and chemokines like MCP-1
Macrophage inflammatory proteins (MIP-1α, MIP-1β)
When macrophages were exposed to sub-cytotoxic concentration of graphene. mRNA level of
three proinflammatory genes
IL-1β
Nitric oxide synthase (iNOS) and
Cyclooxygenase (COX-2)
were reported to be increased upon graphene exposure.
So it’s clear that the mechanisms of graphene & graphene oxide are complex wit numerous biologic effects.
It also appears clear that “Steven Fishman” may not have been completely accurate in his portrayal of the true nature of graphene & graphene oxide toxicity.
We know that these substances are present in the “Covid Shot”
So far, however, we do not know what to expect in the future for the recipients of this “intervention”.
thepainterdoug
28th July 2021, 17:14
effects of the graphene/ latest from LaQuinta lab.
https://www.orwell.city/2021/07/graphene-oxide-and-derealization.html
Graphene oxide causes derealization symptoms in some vaccines
July 28, 2021
Some vaccinees are reporting side effects related to a particular feeling of disconnection with reality after inoculation.
During program 81, Ricardo Delgado from La Quinta Columna has made reference to a video in which a young couple describes that they feel as if they were 'floating in a bubble' after having been inoculated with the Moderna vaccine.
What could be the explanation for this phenomenon? Most likely, the graphene oxide present in the vaccination vial administered to these young people is wreaking havoc at the neuronal level.
Below, La Quinta Columna explains it in detail in the excerpt selected by Orwell City.
Link: Rumble
Ricardo Delgado: These are two naïve young people who have been vaccinated and who notice a rather special sensation. They feel like if 'they were floating'. As if they were a little dispersed from reality. As if they were on another planet. Maybe on the Spike protein planet. Let's take a look at it.
Man from the video: As you saw, here on TikTok, we were vaccinated on Thursday and inoculated with Moderna. It's already Monday and, now, we have a quite strange feeling. We're like...
Woman from the video: With a lack of perception of reality. As if we were floating in a bubble.
Man from the video: Well, it's as if we were in a balloon. And I don't know...
Ricardo Delgado: Just like you said. Lack of perception of reality. Maybe you're getting the intrusive thoughts that Maldita Ciencia was talking about.
To me, personally... I'm going to confess it. Intrusive thoughts are coming to my head that I'm not going to tell you directly. I feel sorry for these two kids because, of course, they have naively run to get the Moderna vaccine. They're in RNA mode.
Of course, they thought they were ultra-responsible and supportive, especially with the immunocompromised population. 'You have to be supportive.' Now they're living in a parallel world —if they weren't already before—, where they perceive reality differently. They say so. I'm going to play it again.
Man from the video: Quite a strange feeling. We're like...
Woman from the video: With a lack of perception of reality. As if we were floating in a bubble.
Ricardo Delgado: 'As if we were floating in a bubble.'
But don't think that these are two isolated testimonies. This is the sensation that many people have after inoculation with toxic graphene oxide.
This probably occurs due to the rupture of neuronal synapses when the graphene oxide nanoparticles cross the encephalic barrier and settle in the brain, in the neurons. And especially when —most likely— neurons are being excited at some frequency quality to cause this kind of phenomenon. They feel like they're floating. Let's listen to it.
Man from the video: It feels like we're in a balloon. I don't know if it's our thing, or some of you have had it happen to you as well, whether it's with Pfizer, Moderna, or other vaccines. So, please leave it for me in the comments for...
Ricardo Delgado: You're in a balloon. You're riding the balloon of death straight up. And you haven't even noticed. Brave new world, as we're being told. 'In 2030, you'll have nothing, but you'll be riding in a balloon. You'll have a different perception of reality with your intrusive thoughts, and you will be happy.' Idiot!
Man from the video: It's just that this... The truth is that this is a little bit strange.
Do you want to get in touch with them? Then you can refer to their official website and follow them on their official channels on Telegram, Instagram, Youtube and Twitch. If you want to contact directly, send them a message to: tutoronline@hotmail.es. Don't worry about the language barrier, they understand English and French.
Remember that Orwell City is not affiliated with La Quinta Columna. This is a website dedicated to gathering important information that this team of researchers delivers (and also from the many others from the Spanish-speaking world who are doing a great job in unmasking the plandemic).
Orwell City summarizes, transcribes, translates, edits and subtitules videos so that everyone can learn about the shocking discovery they have made about the true content of the vaccination vials.
Bill Ryan
28th July 2021, 22:33
This was interesting — from an organization that promotes graphene. (This isn't an alt media article)
https://graphene-flagship.eu/graphene/news/soothing-the-symptoms-of-anxiety-with-graphene-oxide
Soothing the symptoms of anxiety with graphene oxide
Graphene oxide inhibits post-traumatic stress disorder.
Researchers from Graphene Flagship partners SISSA in Italy, ICN2 in Spain and the University of Manchester in the UK, in collaboration with the Ribeirão Preto Medical School of the University of São Paulo, have discovered that graphene oxide inhibits anxiety-related behaviours in a model study. They found that injecting graphene oxide into a specific region of the brain silences the neurons responsible for anxious behaviour.
The scientists used a common animal model: just like in the classic cartoon Tom and Jerry, a mouse lives in a hole in the wall of a small room, where it feels protected and safe. Normally, the mouse explores the room freely and without worry. But when the mouse smells a cat, it runs back into its hole, where it knows it is safe. This is a very strong defensive behaviour and the basis for the fight or flight response, which is intrinsic to most animals.
After one week in this environment, the mouse remembers this behaviour, even after the cat’s scent has gone. This is a model for post-traumatic stress disorder (PTSD), a protective anxiety behaviour that arises in response to negative memories. Millions of people around the world suffer from disorders related to PTSD or anxiety.
Laura Ballerini, lead author of the paper and Professor of Physiology at Graphene Flagship partner SISSA, Italy, explains that graphene oxide disables communication between the synapses that cause this type of fear.
“Two days after injecting graphene oxide into a specific region of the mouse’s brain, it behaved like other mice that had never experienced the smell of a cat in their home environment. In other words, graphene oxide inhibited the mouse’s anxiety-related behaviour,” Ballerini explains. She says that two days is roughly the time for memories to form and be consolidated in the mouse’s brain, which corresponds to the time for the symptoms of anxiety to subside.
“Graphene oxide interacts with the part of the brain responsible for the formation of fear-related memories, which cause anxiety. It doesn’t work like a drug, by inhibiting the function of the receptors – instead, it temporarily halts the entire mechanism long enough to disrupt the brain’s fear-related pathology, without damaging them,” continues Ballerini.
Graphene oxide interrupts anxiety-related neuron signals without affecting the neurons, or the surrounding cells. In simple terms, it only ‘turns down’ the communications between specific neurons. In a disease where these communications are over-expressed, like PTSD and anxiety, targeting the synapses with graphene oxide is enough to halt the development of this pathological behaviour. This is a type of precision medicine.
Graphene oxide is naturally eliminated after a few days, as the surrounding tissue digests the material. Ballerini says that, after two days, they did not observe any inflammation, and no traces of graphene oxide remained at all. Next, Ballerini and colleagues will seek to combine the synapse-targeting behaviour of graphene oxide with its ability to attach to carrier molecules for drug delivery.
Serge Picaud, Deputy Leader of the Graphene Flagship’s Biomedical Technologies Work Package, comments: “This work provides another great demonstration of the therapeutic potential of graphene, used either alone or included in a medical device.”
Andrea C. Ferrari, Science and Technology Officer of the Graphene Flagship and Chair of its Management Panel, adds: “The healthcare, environmental and biological applications of graphene and related materials have been investigated by the Graphene Flagship since its inception. This work opens up a new avenue of research and showcases a path for a very important therapeutic use of graphene oxide – one of the most common forms of functionalised graphene.”
References
“Biagioni, Audrey Franceschi, et al. "Graphene oxide prevents lateral amygdala dysfunctional synaptic plasticity and reverts long lasting anxiety behavior in rats. (https://www.sciencedirect.com/science/article/pii/S0142961221001058)" Biomaterials 271 (2021): 120749.
Gwin Ru
28th July 2021, 22:58
DEADLY SHOTS! Former Pfizer Employee Confirms Poison in COVID 'Vaccine' (https://rumble.com/vkgdq7-deadly-shots-former-pfizer-employee-confirms-poison-in-covid-vaccine.html)
Stew Peters Show (https://rumble.com/c/StewPeters)
Published July 28, 2021
vhu7kx
Rumble (https://rumble.com/) — EXCLUSIVE! Karen Kingston, a former Pfizer employee and current analyst for the pharmaceutical and medical device industries, came forward with indisputable documentation that should be shared with the ENTIRE WORLD!
The inoculation being referred to as 'COVID Vaccines' is a poisonous death sentence, and nobody should subject themselves to the shots.
Bill Ryan
29th July 2021, 00:09
DEADLY SHOTS! Former Pfizer Employee Confirms Poison in COVID 'Vaccine' (https://rumble.com/vkgdq7-deadly-shots-former-pfizer-employee-confirms-poison-in-covid-vaccine.html)
Stew Peters Show (https://rumble.com/c/StewPeters)
Published July 28, 2021
vhu7kx
Rumble (https://rumble.com/) — EXCLUSIVE! Karen Kingston, a former Pfizer employee and current analyst for the pharmaceutical and medical device industries, came forward with indisputable documentation that should be shared with the ENTIRE WORLD!
The inoculation being referred to as 'COVID Vaccines' is a poisonous death sentence, and nobody should subject themselves to the shots.
~~~
Here's the patent which features the application of graphene oxide. (Not the Moderna patent, but the original Chinese one.) The text below is a formal English translation. The formatting was good but not perfect, so I improved it just a tiny bit in one or two places.
https://patents.google.com/patent/CN112220919A/en
~~~
Nano coronavirus recombinant vaccine taking graphene oxide as carrier
Abstract
The invention belongs to the field of nano materials and biomedicine, and relates to a vaccine, in particular to development of 2019-nCoV coronavirus nuclear recombinant nano vaccine. The invention also comprises a preparation method of the vaccine and application of the vaccine in animal experiments. The new corona vaccine contains graphene oxide, carnosine, CpG and new corona virus RBD; binding carnosine, CpG and neocoronavirus RBD on the backbone of graphene oxide; the CpG coding sequence is shown as SEQ ID NO 1; the novel coronavirus RBD refers to a novel coronavirus protein receptor binding region which can generate a high-titer specific antibody aiming at the RBD in a mouse body, and provides a strong support for prevention and treatment of the novel coronavirus.
Classifications
A61K39/12 (https://patents.google.com/?q=A61K39%2f12) Viral antigens
A61K39/385 (https://patents.google.com/?q=A61K39%2f385) Haptens or antigens, bound to carriers
A61K39/39 (https://patents.google.com/?q=A61K39%2f39) Medicinal preparations containing antigens or antibodies characterised by the immunostimulating additives, e.g. chemical adjuvants
A61P31/14 (https://patents.google.com/?q=A61P31%2f14) Antivirals for RNA viruses
C07K14/005 (https://patents.google.com/patent/CN112220919A/en#) Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from viruses
C07K17/14 (https://patents.google.com/?q=C07K17%2f14) Peptides being immobilised on, or in, an inorganic carrier
A61K2039/55561 (https://patents.google.com/?q=A61K2039%2f55561) CpG containing adjuvants; Oligonucleotide containing adjuvants
A61K2039/60 (https://patents.google.com/?q=A61K2039%2f60) Medicinal preparations containing antigens or antibodies characteristics by the carrier linked to the antigen
A61K2039/627 (https://patents.google.com/?q=A61K2039%2f627) Medicinal preparations containing antigens or antibodies characterised by the link between antigen and carrier characterised by the linker
C12N2770/20022 (https://patents.google.com/patent/CN112220919A/en#) New viral proteins or individual genes, new structural or functional aspects of known viral proteins or genes
C12N2770/20034 (https://patents.google.com/patent/CN112220919A/en#) Use of virus or viral component as vaccine, e.g. live-attenuated or inactivated virus, VLP, viral protein
Description
Nano coronavirus recombinant vaccine taking graphene oxide as carrier
Technical Field
The invention belongs to the field of nano materials and biomedicine, and relates to development of a vaccine development platform. In particular to the development of 2019-nCoV coronavirus nuclear recombinant nano-vaccine. The invention also includes the use of the vaccine in animal testing.
Technical Field
The vaccine is an ultimate weapon for eliminating major infectious diseases, has the advantages of lowest cost and more advantages of prior enemy than other therapies, undoubtedly becomes hopeful to the public, the smallpox is eliminated by human beings through vaccination, the poliomyelitis cases are reduced by 99 percent, the infectious diseases such as diphtheria are rare, and the incidence rate of diseases such as measles, neonatal tetanus and the like is remarkably reduced. The effect of vaccines on human health is not excessive, and the birth of each new vaccine is a great victory for human beings to overcome an infectious disease! To date, no medical treatment has been able to have such an important, lasting and profound effect on human health as a vaccine; nor is any therapeutic available to eliminate a disease from the earth at the very least cost of a vaccine.
After the occurrence of SARS-CoV-2 epidemic, different laboratories in China have completed the isolation of virus strains, and in order to make a big step forward in vaccine development, we believe that we will soon have a final weapon for the eradication of SARS-CoV-2, however, until now there is no approved vaccine or drug for the treatment of CoV infection, and there is a great need to develop an effective drug for the treatment or prevention of coronavirus infection and outbreak.
According to the research of coronavirus vaccines such as SARS and MERS, the main target point of the existing coronavirus vaccine is the S protein of coronavirus. Vaccines need to induce not only humoral and cellular immune responses, but also mucosal immune responses, and with the aid of adjuvants to induce balanced Th1 and Th2 pathways to produce truly effective vaccines. At present, the research of more SARS and MERS vaccines mainly focuses on viral vector vaccines and subunit vaccines, and a large number of researches show that the difficulty of SARS and MERS lies in that long-term memory B cells cannot be stimulated to generate, the long-term memory cells in the healed SARS and MERS patients can only last for 2-3 years, immunological memory cannot be generated, and the vaccine development failure is caused, and only 6 potential coronavirus vaccines enter the clinical research stage at present, but no 1 effective vaccine is approved to be marketed.
Disclosure of Invention
The invention aims to provide a coronavirus recombinant vaccine.
Another purpose of the invention is to provide a preparation method of the virus recombinant vaccine.
It is still another object of the present invention to provide the use of the recombinant vaccine of the virus.
In view of various problems of the conventional vaccines at present, how to change the problems of the existing vaccines and enhance immune response is a problem which is always considered, in order to improve the immunocompetence of the immunogen and enhance the immune response capability of the body, the most basic method is to mix the immunogen with an adjuvant, and the immune adjuvant is a promoter capable of enhancing the immune response of the body to the immunogen. CpG Oligodeoxynucleotide (ODN) is a very promising adjuvant discovered in recent years. CpG ODN has been shown to have better adjuvant activity in vivo, in vitro and clinical studies in animals, and the best studies are CpG7909 and CpG 1018. 11/9.2017, the hepatitis B vaccine approved by Dynavax Technologies of the United states of America FDA and using CpG1018 as an adjuvant is on the market, is the first approved CpG ODN adjuvant vaccine in the world and is used for preventing HBV infection of adults 18 years old and older, and a plurality of different types of CpG ODN are used as adjuvants in a plurality of clinical trials. CpG is combined with TLR9 to activate immature pDC cells and induce natural and adaptive immune response, but a single CpG structure has limited activation effect on immune cells and is easy to be rapidly hydrolyzed by exonuclease, so that the stability of the CpG in vivo is insufficient, and side effects are also caused; CpG Oligodeoxynucleotide (ODN) synthesized in the sequence can also enhance the stimulation effect, and after the CpG is coupled with other proteins such as antigen and the like, the CpG oligodeoxynucleotide is combined, so that the CpG oligodeoxynucleotide has a very obvious immune activation effect.
Graphene is a two-dimensional carbon nanomaterial consisting of carbon atoms in sp hybridized orbitals in a hexagonal honeycomb lattice. The basic structural unit of the material is the most stable benzene six-membered ring in the organic material, and the material is the most ideal two-dimensional material at present. Graphene Oxide (GO) is a Graphene oxide derivative, and is a exfoliated product. Due to the characteristics of unique SP2 hybridization, a perfect two-dimensional structure and high reactivity of the edge, the treatment platform based on the hybrid structure can be used as an ideal load and grafting carrier in design and development, and plays an important role in aspects of nano-drug delivery systems, biological detection, tumor treatment, cell imaging and the like.
The present invention has been completed based on the above-mentioned studies.
The invention discloses a brand-new vaccine development method based on a graphene oxide material serving as a framework for loading CpG molecules and recombinant proteins. Based on the technical platform, a new nano new crown vaccine is prepared by combining the recombinant protein of the RBD region of the Spike protein of the SAR-CoV-2. The prepared nano new corona vaccine has stronger immunogenicity in mouse experiments and can generate high-titer antibodies.
In one aspect, the invention provides a coronavirus vaccine comprising graphene oxide, carnosine, CpG, and RBD. In a preferred embodiment of the invention, the vaccine is named GO-Car-carnosine-CpG-RBD vaccine.
Graphene Oxide (GO) is an oxide of graphene, and after oxidation, oxygen-containing functional groups on the graphene oxide are increased, so that the graphene oxide is more active than graphene. For example, hydroxyl groups and epoxy groups are randomly distributed on a graphene oxide monolith, while carboxyl groups and carbonyl groups are introduced at the edge of the monolith. Common commercial products of graphene oxide are in the form of powder, flakes and solutions, and are brown-yellow in color.
Carnosine, known by the scientific name β-alanyl-L-histidine, is a crystalline solid composed of a dipeptide consisting of two amino acids, β-alanine and L-histidine. Carnosine has strong antioxidant ability, and can scavenge Reactive Oxygen Species (ROS) and alpha-beta unsaturated aldehydes, which are formed by over-oxidation of fatty acids in cell membranes during oxidative stress.
CpG motifs have the effect of activating the body's immune system and can be used as adjuvants. Preferably, the CpG coding sequence is shown as SEQ ID NO 1.
RBD (spike receptor binding domain), specifically a coronavirus protein (S protein) Receptor Binding Domain (RBD) in the present invention. For example, the RBD protein can be selected as follows:
PNITNLCPFGEVFNATRFASVYAWNRKRISNCVADYSVLYNSASFSTFKCYGVSPTKLNDLCFTNVYADSFVIRGDEVRQIAPGQTGKIADYNYKLPDDF TGCVIAWNSNNLDSKVGGNYNYLYRLFRKSNLKPFERDISTEIYQAGSTPCNGVEGFNCYFPLQSYGFQPTNGVGYQPYRVVVLSFELLHAP（SEQ ID NO 2）。
the coronavirus vaccine disclosed by the invention is obtained by combining carnosine, CpG and a novel coronavirus RBD on activated graphene oxide.
The dosage of GO in the coronavirus vaccine provided by the invention is used as a framework base, the dosage is usually excessive, and the dosage of carnosine can be about twice of that of GO. CpG and new coronavirus RBD are used as biological macromolecules, and the dosage of the CpG and the new coronavirus RBD is less, and is usually one ten thousandth of that of GO in mass ratio. And RBD is used in an amount more than 2 times that of CpG, such as CpG: RBD = 1: 2-10, preferably, the dosage of RBD is 3-6 times of that of CpG.
In another aspect, the present invention provides a method for preparing the coronavirus vaccine, the method comprising the steps of:
obtaining CpG, RBD recombinant protein and carnosine;
adding freeze-dried GO powder into a phosphate buffer solution, and carrying out ultrasonic treatment;
adding EDC and NHS to activate GO solution, removing excess EDC/sulfo-NHS in the reaction solution through ultrafiltration, and adjusting the pH of the reaction solution to be neutral;
adding carnosine, CpG, and RBD recombinant proteins to the reaction solution, incubating with activated GO;
Excess unconjugated protein was removed from the reaction solution and sterilized for use.
Preferably, the duration of the ultrasound is 2 to 3 hours. The ultrasonic conditions were 200W, 40 kHz.
Preferably, the phosphate buffer has a neutral pH, e.g., 6.8 to 7.6, more preferably 7.0 to 7.4, or 7.2.
Preferably, the method of removing excess EDC/sulfo-NHS or unconjugated protein is ultrafiltration.
In a preferred embodiment of the present invention, the ratio of graphene oxide, carnosine, CpG, and RBD is: 26 mg: 40 mg: 1.2. mu.g: (3-6) μg.
Preferably, the reaction temperature is 20-28 ℃. For example, room temperature is used.
In a preferred embodiment of the present invention, the GO-Car-carnosine-CpG-RBD vaccine is prepared by the following method: GO was coupled to carnosine using a modification of the EDC-NHS reaction, 26mg of GO lyophilized powder was added to 5.20 mL of phosphate buffer (PBS, pH = 7.4) and sonicated (200W, 40 kHz) at 25 ℃ for 3 h. The GO solution was activated by the addition of 6.82 mg EDC (N1- ((ethylimino) methyl-ene) -N3, N3-dimethyl propane-1,3-diamine, Chinese: 1- (3-dimethylaminopropyl) -3-ethylcarbodiimide) and 7.73 mg NHS (N-N-hydroxysuccinimide) at 25 ℃. Excess EDC/sulfo-NHS was removed from the reaction solution by ultrafiltration and the pH of the solution was then adjusted to 7.4. Then, 40mg of carnosine, 1.2μg CpG, and various concentrations of RBD recombinant protein were added to the solution and reacted with activated GO at 25 ℃ for 2 h. Subsequently, excess unconjugated protein was removed from the reaction solution by ultrafiltration. The prepared product is marked as GO-Car-carnosine-CpG-RBD vaccine. Finally, GO-Car-carnosine-CpG-RBD vaccine solution was contacted with sterile filter (0.22 um) and stored in sterile containers at 4 ℃ for subsequent experiments.
The invention establishes a nano recombinant protein vaccine preparation technical platform capable of quickly exciting the human immune system, and can quickly produce a large amount of preventive vaccines after infectious viruses are confirmed. The technical platform fully utilizes the characteristic that the surface of graphene oxide is provided with COOH, hydroxyl and other groups, and utilizes the interaction between pi-pi bonds to assemble the screened RBD recombinant protein, CpG molecules and carnosine together to prepare the nano recombinant protein vaccine based on the graphene oxide as the framework. The vaccine can stimulate an organism to generate a high-titer RBD neutralizing antibody aiming at SAR-CoV-2, and lays a technical foundation for preventing and treating coronavirus infection and future large outbreaks of similar epidemics.
In another aspect, the invention provides an application of the GO-Car-carnosine-CpG-RBD vaccine, namely an application of the GO-Car-carnosine-CpG-RBD vaccine in preparation of a medicine for preventing a new coronavirus.
Preferably, the application of the composition can improve the immunity of organisms to the new coronavirus.
Preferably, the GO-Car-carnosine-CpG-RBD vaccine can generate specific antibodies aiming at RBD, and the specific antibody titer is high. In the embodiment of the invention, the nano neocorona vaccine realizes stronger immunogenicity in a mouse test and can generate high-titer antibodies.
The invention has the beneficial effects that:
A brand-new vaccine technical platform is developed for a framework loaded CpG molecule and recombinant protein based on a graphene oxide material and combined with the recombinant protein of the RBD region of the Spike protein of SAR-CoV-2 to prepare a novel nano coronavirus vaccine, a high-titer specific antibody aiming at the RBD can be generated in a mouse body, and a strong support is provided for prevention and treatment of novel coronavirus.
Drawings
In order to more clearly illustrate the technical solutions in the embodiments of the present application, the drawings needed to be used in the embodiments will be briefly described below, and it is obvious that the drawings in the following description are only some embodiments of the present application, and it is obvious for those skilled in the art to obtain other drawings without creative efforts.
FIG. 1 is a schematic diagram and time schematic representation of GO-Car-carnosine-CpG-RBD vaccine mouse immunization;
FIG. 2 shows the change of specific RBD antibody in serum 28 days after the mice were immunized and the change of cytokine production by spleen cells 42 days after the mice were immunized.
Detailed Description
The technical solutions in the embodiments of the present application will be described clearly and completely below, and it should be understood that the described embodiments are only a part of the embodiments of the present application, and not all embodiments. All other embodiments, which can be derived by a person skilled in the art from the embodiments given herein without making any creative effort, shall fall within the protection scope of the present application. Methods and techniques not specifically described may be performed using techniques conventionally known in the art. For example, refer to molecular cloning handbook of cold spring harbor.
Example 1
Preparation process of Graphene Oxide (GO) -carnosine-CpG-RBD recombinant protein vaccine preparation
Selecting a TLR9 receptor nucleic acid sequence CpG ODN M362 which has cross reaction to both human and mouse, wherein the specific sequence is as follows: 5 '-TCGTCGTCGTTC: GAACGACGTTGAT-3' (25 mer, SEQ ID NO 1), coupling GO with carnosine using a modification of the EDC-NHS reaction, 26mg of a lyophilized powder of GO was added to 5.20 mL of phosphate buffer (PBS, pH = 7.4) and sonicated (200W, 40 kHz) at 25 ℃ for 3 h. The GO solution was activated by the addition of 6.82 mg EDC (N1- ((ethylimino) methyl-ene) -N3, N3-dimethyl propane-1,3-diamine, Chinese: 1- (3-dimethylaminopropyl) -3-ethylcarbodiimide) and 7.73 mg NHS (N-N-hydroxysuccinimide) at 25 ℃. Excess EDC/sulfo-NHS was removed from the reaction solution by ultrafiltration and the pH of the solution was then adjusted to 7.4. Then, 40mg of carnosine, 1.2μg CpG, and various concentrations of RBD recombinant protein were added to the solution and reacted with activated GO at 25 ℃ for 2 h. Subsequently, excess unconjugated protein was removed from the reaction solution by ultrafiltration. The prepared product is marked as GO-Car-carnosine-CpG-RBD vaccine. Finally, GO-Car-carnosine-CpG-RBD vaccine solution was contacted with sterile filter (0.22 um) and stored in sterile containers at 4 ℃ for subsequent experiments.
Example 2
Test of Graphene Oxide (GO) -carnosine-CpG-RBD recombinant protein vaccine immunized mice
6-week-old female BALB/c mice were immunized by subcutaneous injection at 0, 14, and 28 days, respectively, for 28 days and 42 days according to the schedule shown in FIG. 1, blood was collected by drawing blood at , and serum was separated and tested for specific antibodies against RBD. Mice were sacrificed at 42 days, splenocytes isolated, and tested for specific T cell immune responses and cytokine secretion.
Grouping and dose determination of immunized mice:
1. (graphene oxide + carnosine) + 1.2μg cpG +3μg RBD
2. (graphene oxide + carnosine) + 1.2μg cpG +6μg RBD
3. Aluminum hydroxide +6μg RBD (1: 1)
4. 6μg RBD
5. Liposome (lipo) +6μg RBD group
Mouse strains: BALB/c mic (n = 6).
The schedule for immunization of mice with the GO-Car-carnosine-CpG-RBD vaccine is: blood was collected and first immunized as starting point for immunization of mice. And (5) collecting blood for the second time on the 7 th day, and inspecting a new corona virus adding system to master the principle. Collecting blood for the third time on day 14, and enhancing immunity. Collecting blood for the fourth time on day 28, enhancing immunity, detecting antibody in serum, and if positive, preparing to collect spleen cells. The fifth blood collection on day 42, after which the blood was sacrificed and splenocytes were isolated and subjected to cytokine experiments.
The test results show that 3μg and 6μg groups of the GO-Car-carnosine-CpG-RBD vaccine generate high-titer specific antibodies for RBD after mice are immunized, and the GO-Car-carnosine-CpG-RBD vaccine is significantly different from the traditional adjuvant group, the RBD group and the liposome group (figure 2). Further analyzing the specific immune response of the T cells separated from the spleen, the result shows that the GO-Car-carnosine-CpG-RBD vaccine can stimulate the organism to generate specific IFN-gamma cytokines, improve the immunity of the organism and resist the epidemic situation of new coronavirus.
The above description is only for the specific embodiments of the present application, but the scope of the present application is not limited thereto, and any changes or substitutions that can be easily conceived by those skilled in the art within the technical scope of the present disclosure should be covered within the scope of the present application. Therefore, the protection scope of the present application shall be subject to the protection scope of the claims.
~~~~
The original is here, in Chinese, this document containing the illustrations.
The application was filed by Shanghai National Engineering Research Center for Nanotechnology Co Ltd (https://patents.google.com/?assignee=Shanghai+National+Engineering+Research+Center+for+Nanotechnology+Co+Ltd) on 27 September, 2020.
https://patentimages.storage.googleapis.com/ef/0c/d4/2ed14dae3576f1/CN112220919A.pdf
https://patentimages.storage.googleapis.com/ef/0c/d4/2ed14dae3576f1/CN112220919A.pdf
Gwin Ru
29th July 2021, 00:35
...
... the reasons why defiant heads of states died and why no amount of logic or rationality can even put a dent in the resolve of subservient governments to mandate "vaccines":
Pfizer has hit the goldmine during Covid Crisis, alleged leaked contract shows appalling terms and conditions (https://tfiglobalnews.com/2021/07/28/pfizer-has-hit-the-goldmine-during-covid-crisis-leaked-contract-shows-appalling-terms-and-conditions/)
Leaked confidential agreement allegedly between Pfizer and Albania reveals how Pfizer is ripping off countries
https://secure.gravatar.com/avatar/d50d5069ab3e61cfc82a8abbe5ba19a8?s=80&d=mm&r=g by Abhyoday Sisodia (https://tfiglobalnews.com/author/abhyodaysisodia/)
July 28, 2021 (https://tfiglobalnews.com/2021/07/28/pfizer-has-hit-the-goldmine-during-covid-crisis-leaked-contract-shows-appalling-terms-and-conditions/)
in Americas (https://tfiglobalnews.com/category/americas/)
Reading Time: 3 mins read
https://tfiglobalnews.com/wp-content/uploads/2021/07/1-16-750x375.jpg (https://tfiglobalnews.com/wp-content/uploads/2021/07/1-16.jpg)
If someone wants to look at how low these pharma companies can stoop to maximise their profits even when the whole of humanity is facing a global pandemic, look no further than Pfizer. While the company tried to hide its manufacturing and supply agreements behind confidentiality, the alleged agreement with the Albanian government has seemingly spilled the beans. It elaborates on the (https://twitter.com/eh_den/status/1419683893469487109) crony capitalist, profit maximisation and neo-colonial approach of the pharma company. After this allegation, Pfizer has a lot to answer for.
Pfizer has been extremely aggressive in trying to protect the details of its international COVID19 vaccine agreements. However, the latest leak claimed by Twitter user Ehden, who is an information security and privacy professional based in the United Kingdom, has revealed startling details allegedly about the Pfizer vaccine agreement with the Albanian government. It is in some sort similar to the agreements Western powers would have made with their colonies, these are the modern formulation of unequal treaties.
1419653002818990085
1419682762974547970
The alleged leaked confidential agreement is with the government of Albania and it not only covers the manufacturing of vaccines for COVID19 and its mutations, but also for “any device, technology, or product used in the administration of or to enhance the use or effect of, such vaccine”. So here vaccine is used as an umbrella term for everything related to vaccines under the sun. The alleged agreement does not allow signatory countries to escape their contract, which states that even if a drug will be found to treat COVID19 the contract cannot be voided. This is the reason why many governments were not enthusiastic about employing Ivermectin, given it would have only added to the cost.
So this is one of the many examples in the (https://twitter.com/eh_den/status/1419683893469487109) alleged agreement which raises suspicion about Pfizer being more concerned about maximising profit rather than using its resources for the betterment of the people. The alleged agreement goes on to say, while Pfizer shall not be liable to the failure to deliver doses in accordance with est delivery dates, it will have the power to decide on necessary adjustments to the number of contracted doses and delivery schedule due to the purchaser based on principles to be determined by Pfizer and the purchaser shall be deemed to agree to any revision, decided by Pfizer.
The alleged document stated that the purchaser acknowledges the long-term effects and efficacy of the vaccine are not currently known and that there may be adverse effects of the vaccine that are not currently known. So even if the vaccine leads to some problems, the purchaser cannot sue the company, what a noble act!
It further states that the purchaser hereby agrees to indemnify, defend and hold harmless Pfizer, BioNTech (and) their affiliates from and against any and all suits, claims, actions, demands, losses, damages, liabilities, settlements, penalties, fines, costs and expenses. So the purchaser state has been made responsible to save this big pharma company, against the complaints of its own citizens. Through the allegedly leaked confidential agreement, the Twitter user claims that Pfizer (https://twitter.com/eh_den/status/1419683893469487109) shall also have the right to assume control of such defence and the purchaser shall pay all losses, including, without limitation, the reasonable attorneys’ fees and other expenses incurred.
To further raise questions about profit maximisation and hollow ethics of the company, the alleged agreement revealed that the vaccines were sold for $12 to Albania, while it was sold at the rate of $19 per shot in the US and Israel.
Related:
China “donated” vaccines to Vietnam but under one caveat: The vaccines are not for Vietnam (https://tfiglobalnews.com/2021/06/27/china-donated-vaccines-to-vietnam-but-under-one-caveat-the-vaccines-are-not-for-vietnam/)
Nations that accepted Chinese vaccines are bracing for a huge Covid disaster but Japan has come to their rescue (https://tfiglobalnews.com/2021/06/26/nations-that-accepted-chinese-vaccines-are-bracing-for-a-huge-covid-disaster-but-japan-has-come-to-their-rescue/)
Satori
29th July 2021, 00:40
Holy f***ing s**t. This is so off the charts. It’s beyond evil. This is an entirely new dimension of evil.
Edit: I’m referring to post #82, the Stew Peters video and the additional information provided by Bill.
Sue (Ayt)
29th July 2021, 06:37
I found several older links that prove that Karen Kingston (from Stew Peters video, posts 81 and 82 above) is who she claims to be.
This video is a MUST WATCH, and truly terrifying.
Karen Kingston - who is she? Some older links:
https://www.tsnn.com/news/healthcare-convention-exhibitors-association-names-huff-president-announces-new-board-members
https://www.neovirucide.com/scientificboard
https://www.nmbtherapeutics.com/scientificboard
http://varitage.com/founder/
https://seekingalpha.com/article/1432701-the-4-healthcare-companies-investors-should-be-watching
https://marketcaliber.com/2013/05/15/company-spotlight-update-5152013/
Ewan
29th July 2021, 19:51
Wow, wow and wow!
Best I can come up with after a sixteen hour day and needing to sleep.
I can only pray that a large percentage of vaccinations have been placebo, because, quite frankly, it really looks like the rest are screwed.
Edit to add: Hope Stew and Karen don't have a strange accident in the near future.
Constance
29th July 2021, 20:40
lV4jGbXNtFU
Synthetic and living micropropellers stir up nanoparticles
Gwin Ru
30th July 2021, 00:45
...
... the reasons why defiant heads of states died and why no amount of logic or rationality can even put a dent in the resolve of subservient governments to mandate "vaccines":
Pfizer has hit the goldmine during Covid Crisis, alleged leaked contract shows appalling terms and conditions (https://tfiglobalnews.com/2021/07/28/pfizer-has-hit-the-goldmine-during-covid-crisis-leaked-contract-shows-appalling-terms-and-conditions/)
[...]
Pfizer Contracts Exposed (https://forbiddenknowledgetv.net/pfizer-contracts-exposed/)
16 hours ago
vhuyrj
Cybersecurity Expert Ehden Biber has legally obtained copies of the Pfizer contracts with Albania, Brazil, Israel and the EU.
He discovered the first one on an Albanian website, where it was published on January 2021. Its veracity was confirmed when he was able to see Brazil’s Pfizer contract, which is virtually identical on that country’s health ministry website, with a signature that was verified by DocuSign. He has since seen virtually same contract with the EU and heard the details of Israel’s Pfizer contract.
The contract, which exposes Pfizer to zero liability for anything and places the liability for everything on the government, which is called the “Purchaser” in the contract.
The deal is a criminal shakedown of epic proportions, the likes of which it is hard to even fathom. Why would anybody sign it?
Reading the contract’s language sheds some light on the inexplicable behavior of the government authorities of the world and on the true nature of this whole COVID operation.
It also may shed light on the untimely deaths of two African presidents and the Haitian president, who all very understandably refused to sign this contract!
In his blog, Biber wrote, “If you were wondering why #Ivermectin was suppressed, well, it is because the agreement that countries had with Pfizer does not allow them to escape their contract, which states that even if a drug will be found to treat COVID19, the contract cannot be voided.”
And here’s a shocking clause about supplying the product:
“Pfizer shall have no liability for any failure to deliver doses in accordance with any estimated delivery dates… nor shall any such failure give Purchaser any right to cancel orders for any quantities of Product.
“Pfizer shall decide on necessary adjustments to the number of Contracted Doses and Delivery Schedule due to the Purchaser … based on principles to be determined by Pfizer … Purchaser shall be deemed to agree to any revision.”
So Pfizer can breach its own contract but their hitmen will kill you if you refuse to sign it!
You can really see how this Globalist entity that is Pfizer hates nation states and will not recognize their laws but it acts like a “government that dictates to other governments around the world,” as Biber says. If we look around at the complete lawlessness and the meltdown of once-solid institutions all over the world, you can see that Big Pharma is being used like a massive battering ram against the national laws and national sovereignty of all nations.
The contract forces the “Purchaser”, which is how they refer to the nation that is contracting with them to defend Pfizer’s interests and not those of the citizens they’re supposed to be representing and defending – and whose taxpayer money they’re using to pay Pfizer these billions of dollars.
As Biber tweeted, Israel has turned into a pharmaceutical #BananaRepublic, where the priorities of a multinational supercedes the priorities of its citizens.
Not only is Pfizer held completely harmless from all claims, the “Purchaser”, ie, the national government is responsible for Pfizer’s legal defense against any and all claims!
However, “Pfizer shall have the right to assume control of such defense… and Purchaser shall pay all Losses, including, without limitation, the reasonable attorneys’ fees and other expenses incurred.” Pfizer makes sure the country will pay for everything.
I really don’t get why governments across the world have signed this. What’s in it for them? Did they sign this voluntarily? It really seems like a colossal shakedown and a complete abdication on the part of these governments to protect their people. It’s malfeasance on a scale that beggars belief.
THE ONLY WAY to get a product recall on these shots is if you can prove fault in Current Good Manufacturing Practice (CGMP), which is regulated by the FDA.
However, CGMP will tell you NOTHING about mRNA, because we don’t have CGMP for an mRNA vaccine, so you cannot prove CGMP malpractice.
Contributed by Alexandra Bruce (https://forbiddenknowledgetv.net/author/alexandra/)
Contact (alexandra.bruce18@gmail.com)
Gwin Ru
30th July 2021, 13:04
Black Junk Surgically Removed From Injection Site With Magnet & Scalpel (https://www.bitchute.com/video/aZMS3ybwH2Qy/) 03:24
Watch (https://www.bitchute.com/video/aZMS3ybwH2Qy/#video-watch)
First published at 14:31 UTC on July 29th, 2021.
Tim Truth (https://www.bitchute.com/channel/timtruth/)
Tim Truth (https://www.bitchute.com/profile/ZdSH7AXbCQWL/)
aZMS3ybwH2Qy
Join our leading researchers on https://GroupDiscover.com to find the best videos from across the censorship-resistant internet platforms like Odysee, Rumble, LBRY, Bitchute & Brighteon.
thepainterdoug
31st July 2021, 12:15
perhaps a key relevant 2016 article from the Guardian UK that Dr Joseph Farrell recently took time to read to his audience.
Could this be the connection to the magnetism, the Graphene Oxide and the mad push to get this into every arm ?
https://www.theguardian.com/science/neurophilosophy/2016/mar/24/magneto-remotely-controls-brain-and-behaviour
onawah
31st July 2021, 16:56
Genetically engineered 'Magneto' protein remotely controls brain and behaviour
(Here's that scary article ):
https://i.guim.co.uk/img/media/673f91ceeae07d1fae8cce33ca7b30fed0d6e92b/0_120_1000_600/master/1000.jpg?width=1020&quality=85&auto=format&fit=max&
"The toroidal magnetic chamber (Tokamak) of the Joint European Torus (JET) at the Culham Science Centre. Photograph: AFP/Getty Images
“Badass” new method uses a magnetised protein to activate brain cells rapidly, reversibly, and non-invasively
Mo Costandi
@mocost
Thu 24 Mar 2016 10.30 EDT
Researchers in the United States have developed a new method for controlling the brain circuits associated with complex animal behaviours, using genetic engineering to create a magnetised protein that activates specific groups of nerve cells from a distance.
Understanding how the brain generates behaviour is one of the ultimate goals of neuroscience – and one of its most difficult questions. In recent years, researchers have developed a number of methods that enable them to remotely control specified groups of neurons and to probe the workings of neuronal circuits.
The most powerful of these is a method called optogenetics, which enables researchers to switch populations of related neurons on or off on a millisecond-by-millisecond timescale with pulses of laser light. Another recently developed method, called chemogenetics, uses engineered proteins that are activated by designer drugs and can be targeted to specific cell types.
Although powerful, both of these methods have drawbacks. Optogenetics is invasive, requiring insertion of optical fibres that deliver the light pulses into the brain and, furthermore, the extent to which the light penetrates the dense brain tissue is severely limited. Chemogenetic approaches overcome both of these limitations, but typically induce biochemical reactions that take several seconds to activate nerve cells.
The new technique, developed in Ali Güler’s lab at the University of Virginia in Charlottesville, and described in an advance online publication in the journal Nature Neuroscience, is not only non-invasive, but can also activate neurons rapidly and reversibly.
Several earlier studies have shown that nerve cell proteins which are activated by heat and mechanical pressure can be genetically engineered so that they become sensitive to radio waves and magnetic fields, by attaching them to an iron-storing protein called ferritin, or to inorganic paramagnetic particles. These methods represent an important advance – they have, for example, already been used to regulate blood glucose levels in mice – but involve multiple components which have to be introduced separately.
The new technique builds on this earlier work, and is based on a protein called TRPV4, which is sensitive to both temperature and stretching forces. These stimuli open its central pore, allowing electrical current to flow through the cell membrane; this evokes nervous impulses that travel into the spinal cord and then up to the brain.
Güler and his colleagues reasoned that magnetic torque (or rotating) forces might activate TRPV4 by tugging open its central pore, and so they used genetic engineering to fuse the protein to the paramagnetic region of ferritin, together with short DNA sequences that signal cells to transport proteins to the nerve cell membrane and insert them into it.
iHTpJNSNFlc
In vivo manipulation of zebrafish behavior using Magneto. Zebrafish larvae exhibit coiling behaviour in response to localized magnetic fields. From Wheeler et al (2016).
When they introduced this genetic construct into human embryonic kidney cells growing in Petri dishes, the cells synthesized the ‘Magneto’ protein and inserted it into their membrane. Application of a magnetic field activated the engineered TRPV1 protein, as evidenced by transient increases in calcium ion concentration within the cells, which were detected with a fluorescence microscope.
Next, the researchers inserted the Magneto DNA sequence into the genome of a virus, together with the gene encoding green fluorescent protein, and regulatory DNA sequences that cause the construct to be expressed only in specified types of neurons. They then injected the virus into the brains of mice, targeting the entorhinal cortex, and dissected the animals’ brains to identify the cells that emitted green fluorescence. Using microelectrodes, they then showed that applying a magnetic field to the brain slices activated Magneto so that the cells produce nervous impulses.
To determine whether Magneto can be used to manipulate neuronal activity in live animals, they injected Magneto into zebrafish larvae, targeting neurons in the trunk and tail that normally control an escape response. They then placed the zebrafish larvae into a specially-built magnetised aquarium, and found that exposure to a magnetic field induced coiling manouvres similar to those that occur during the escape response. (This experiment involved a total of nine zebrafish larvae, and subsequent analyses revealed that each larva contained about 5 neurons expressing Magneto.)
In one final experiment, the researchers injected Magneto into the striatum of freely behaving mice, a deep brain structure containing dopamine-producing neurons that are involved in reward and motivation, and then placed the animals into an apparatus split into magnetised a non-magnetised sections. Mice expressing Magneto spent far more time in the magnetised areas than mice that did not, because activation of the protein caused the striatal neurons expressing it to release dopamine, so that the mice found being in those areas rewarding. This shows that Magneto can remotely control the firing of neurons deep within the brain, and also control complex behaviours.
Neuroscientist Steve Ramirez of Harvard University, who uses optogenetics to manipulate memories in the brains of mice, says the study is “badass”.
“Previous attempts [using magnets to control neuronal activity] needed multiple components for the system to work – injecting magnetic particles, injecting a virus that expresses a heat-sensitive channel, [or] head-fixing the animal so that a coil could induce changes in magnetism,” he explains. “The problem with having a multi-component system is that there’s so much room for each individual piece to break down.”
“This system is a single, elegant virus that can be injected anywhere in the brain, which makes it technically easier and less likely for moving bells and whistles to break down,” he adds, “and their behavioral equipment was cleverly designed to contain magnets where appropriate so that the animals could be freely moving around.”
‘Magnetogenetics’ is therefore an important addition to neuroscientists’ tool box, which will undoubtedly be developed further, and provide researchers with new ways of studying brain development and function."
Reference
Wheeler, M. A., et al. (2016). Genetically targeted magnetic control of the nervous system. Nat. Neurosci., DOI: 10.1038/nn.4265 [Abstract]
perhaps a key relevant 2016 article from the Guardian UK that Dr Joseph Farrell recently took time to read to his audience.
Could this be the connection to the magnetism, the Graphene Oxide and the mad push to get this into every arm ?
https://www.theguardian.com/science/neurophilosophy/2016/mar/24/magneto-remotely-controls-brain-and-behaviour
Sue (Ayt)
1st August 2021, 21:52
ELECTROMAGNETICS EXPERT BREAKS DOWN GRAPHENE OXIDE IN THE VAX, AND 'DELGADO'S BULL.'
Q Clearance (Formerly) researcher and electromagnetics expert, Ginny Silcox, joins us once again to discuss an alarming connection - the ingredients in the vaccines, like Graphene Oxide, are turning peoples blood into living high receptivity antenna. And the implications are hellish.
FyoQ7vQZymcC
(Searching Ginny Silcox on PA brings her up in the past in our threads about the California Fires and energy weapons. Further searching her as "Virginia Silcox" does show that she was at one time a training specialist II for the DOE/NNSA Emergency Operations training academy.)
Karezza
2nd August 2021, 08:48
Removal of NanoWorms Video (https://odysee.com/@EternalAcademy:b/removal-of-nanoworms-dreamcatcher-movie:2) - Amanita Mascaria - Alexander Nairanovsk Protocol
Amanita Mascaria or Fly agaric preparation. Here is what steps I take:
1. Find Amanita Mascaria mushrooms and bring home only tops - hats.
2. I take red skin off with white dots and then dry them really good - crispy. Cut in pieces.
3. Wait 2 month and allow more ibotenic acit to evaporate.
3. Boil (simmer) for 20 mintues on small stove fire.
4. Yes, you can use lemon juice or citric acid. This helps to further remove ibotenic acid (which makes you throw up). Muscimol is left behind (good chemical).
5. I them mix this tea liquid with fruits in blender: banana, strawberry, nuts, seeds, blueberries....anything you like to make it delicious. Those berries by the way can replace lemon juice. I stopped purchasing lemon here in Belarus, it is way to expensive nowadays, because of this new "disease".
I hope this helps.
Pure gum spirits of turpentine (https://projectavalon.net/forum4/showthread.php?63907-100-Pure-Gum-Turpentine-Kerosene-Kill-deadly-Candida-leave-healthy-bacteria-alone-) is useful in the removal of parasites. Looking at Glutathione and its precursor N-acetylcysteine to remove Grapene -PaulGKTW (in comments).
greybeard
2nd August 2021, 17:52
the-vax-causes-the-virus-to-be-more-dangerous-mrna-vaccine-technology-inventor-warns
https://new.awakeningchannel.com/the-vax-causes-the-virus-to-be-more-dangerous-mrna-vaccine-technology-inventor-warns/
Sérénité
2nd August 2021, 20:40
FORMER PFIZER EMPLOYEE CONFIRMS POISONOUS GRAPHENE OXIDE IN THE COVID JABS
Former Pfizer employee Karen Kingston is interviewed here with her findings on Graphene oxide being in the vaccines...
The fact checkers have been out in force saying it isn’t present in the ‘vaccines’ but her investigations prove it is.
She breaks down in this interview, visibly distressed at what may happen to people being poisoned by the Graphene. She refused to go down the road if confirming it could be used once activated for mind control. But she does confirm it’s ability to be a conductor when exposed to an external source of emf.
As a side note, I decided to research the origins of Graphene Oxide recently.
Apologies if it’s mentioned in this thread previously, I need to go back and re read it all.
But the two guys that originally discovered GO, Professor Andre Geim and Professor Kostya Novoselov, they now run the Graphene Institute here in Manchester, opened in c2015.
And one of the guys, Andre Geim, has clear funding links coming from Bill & Melinda Gates Foundation.
https://www.bitchute.com/video/3WagY494Nxnn/
https://www.graphene.manchester.ac.uk/
Constance
2nd August 2021, 20:57
fffffffffffffffffffffffffffffffff
Sérénité
2nd August 2021, 22:51
That’s the one Constance, Thankyou.
Seems Andre Geim is the one working with Bill Gates Foundation on the Graphene condoms. Not a location on the body you’d want wrapped in Graphene I’m sure. Sounds more like potential sterilisation that birth control to me!
avid
3rd August 2021, 09:35
Just found this disturbing article about GO use in water treatment.
https://www.watertechonline.com/industry/article/14207913/g2o-water-technologies-contract-approved-to-use-graphene-oxide-to-coat-water-filtration-membranes?fbclid=IwAR1dR6pShhiXKfU6yWbSd0SUFYtZPDumo7mbXqxpzf-Rb1FyKml-mZoaWNg
Eva2
3rd August 2021, 17:48
There are reports that this is being planned for Canada too - not sure what to do about the drinking water then if you are on the municipal supply system.
https://scontent.fyvr1-1.fna.fbcdn.net/v/t1.6435-9/229684538_567732741251218_8123631816541411003_n.jpg?_nc_cat=100&ccb=1-3&_nc_sid=730e14&_nc_ohc=tjm5wsXYUfkAX-7sjxD&_nc_ht=scontent.fyvr1-1.fna&oh=f2a819502c4759df07a54171d2f9e3b2&oe=6130027A
Eva2
4th August 2021, 15:07
https://smartwatermagazine.com/news/g2o-water-technologies/milestone-contract-graphene-technology-water-treatment?fbclid=IwAR2Rwf--JOkDXyOcBlu_E2uZPpheJCVgzpSIMq8AymmDnsb6I4PlhdV1GBI
'Milestone contract for graphene technology in water treatment'
UK technology business awarded first commercial business contract for industrial wastewater treatment
Graphene technology slashes energy costs and reduces fouling for water treatment
Initial applications in commercial laundry, produced water, food, beverages and dairy industries
30/07/2021
About the entity
G2O Water Technologies
Companies
121
G2O Water Technologies
G2O is a fast-growing technology business with a portfolio of products that reduce the cost and environmental impact of water treatment. Our products harness the transformational potential of 2D materials, such as Graphene Oxide.
TwitterLinkedInWeb
ACCIONA
THEMES
INDUSTRIAL | WATER TREATMENT
UK technology business G2O Water Technologies has landed its first commercial contract for the enhancement of water filtration membranes with graphene oxide. This is particularly significant for both the technology company as well as the water sector globally, as it is the first commercially successful application of the recently developed “wonder” material for water treatment.
The advantages of using graphene oxide lie in the enhancement of membrane performance, as it mitigates the effects of fouling – one of the biggest challenges operators of membrane-based water filtration systems face. With a coating of graphene oxide, successfully developed and piloted by the company in the northwest of England in collaboration with Hydrasyst Limited, operators can improve operational efficiency, reduce energy consumption and decrease chemical usage. It is anticipated that this will extend the lifetime of the membranes, as well as significantly reducing the cost and environmental impact of water treatment.
Hydrasyst, the earliest adopter of the technology, is a British turnkey solution provider of advanced membrane technology systems, particularly in industrial processes. Commenting on its work with G2O, Managing Director Kyle Wolff stated, “We’re thrilled to have been closely involved for some time now with the piloting and application of G2O Water Technology’s graphene oxide coatings. They have ultimately succeeded in proving their value for some of the most difficult water treatment challenges our customers face; for example in the industrial laundry sector. With the graphene oxide coating, our ceramic hollow-fibre membrane systems deliver significant operational advantages, enabling end-users to enhance the efficiency of their water usage, whilst delivering significant savings in energy costs .”
“This is a significant milestone for the company and the whole water sector. It’s the first commercially successful application of graphene oxide for water treatment”, said Chris Wyres, CEO of G2O Technologies. “The results of industrial trials with Hydrasyst validate the real-world advantages the solution delivers. We will be working closely with Hydrasyst to roll-out Nanopulse systems for a range of water treatment applications. We envisage that wide-scale deployment of this transformational solution can contribute to addressing the challenges of water scarcity and climate change.”
thepainterdoug
9th August 2021, 02:37
WHAT THEY WANT IS TO OVERRIDE OUR WILL.
Dr. Luis Marcelo Martínez and Ricardo Delgado on nanotechnology in the vaccines: 'What they want is to override our will'
Tags: COVID-1984, Dr. Luis Marcelo Martínez, English subs, Experimental vaccines, God Gene, La Quinta Columna, Nanotechnology, Ricardo Delgado, Spanish audio, Transhumanism, VMAT2
August 08, 2021
Geneticist Dean Hamer has conducted several investigations related to the VMAT2 gene, better known as the God gene. According to his research, the connection to the divine is encoded in our DNA.
Source: Symbiosis, International Journal of Genetic Science
At a conference he held at the Pentagon in 2005, he spoke about how the expression of this gene could be reduced in religious fundamentalists. According to him, this process could be carried out through vaccines.
Link: Rumble
Although this lecture is already well known among those who have been investigating what the elite have planned for humanity, it's still unknown information for the rest of the population. The suppression of the VMAT2 gene would not only mean that an individual would not express a tendency to religion, but would cease to cognitively question authority. In other words, the subject who has had this gene inhibited is completely manipulable and easily subjected to any discipline. A quite attractive dream to the elite who seek to control at all costs.
This being a proven reality. It's not unreasonable to think that in addition to graphene and other crap that goes in the vaccines, there is specialized nanotechnology that seeks to break the will of human beings.
In this regard, Ricardo Delgado from La Quinta Columna and geneticist Dr. Luis Marcelo Martinez discussed the issue a few days ago.
Orwell City brings the video in English for all its followers.
Link: Rumble
Dr. Luis Marcelo Martínez: World Economic Forum. What is it all about? All of this is already written and is part of what is called the 20/30 agenda. It's written already, and they tell you about it. The World Economic Forum says that in ten years, nobody is going to own anything and be happy about it.
And that they're going to control even your thoughts. How do you take control of a human being's thoughts? Is that the objective of the nanotechnology that's being used in these vaccines? Is it the control of human thought and will? From the bioelectrical point of view, through nanobots and behavior modulation through genetic manipulation. A question that has been asked in the world.
The VMAT2 gene encodes the production of GABA. GABA (gamma-aminobutyric acid) is a critical neurotransmitter involved in human behavior and will. If you silence that gene, you bring the human will to the level of a dog. And they have done that as a way of dealing with religious fundamentalism.
Ricardo Delgado: That's the famous God gene that when the so-called genome was deciphered in 2001, it was somehow isolated. That famous VMAT2 was like the one associated with religious fundamentalism. The famous 'God gene'. And it was tested. The experiment that was done was to mix a coronavirus, precisely, with the influenza virus. I've seen the conference. And it was then observed that in a certain brain region of the hypothalamus a person developed less than religious fundamentalist gene. It was less abrupt, let's say. As if they really... What they want is to override our will. Not only spiritual but the whole will.
Dr. Luis Marcelo Martínez: And, factually, we know it because scientific papers abound from which viral vectors can be used. And you can modulate the expression of genes. Absolutely. In other words, I'm not talking about a novelty. I'm not just guessing at anything. We, geneticists, know this.
If you want to get in touch with geneticist Luis Marcelo Martínez, you can reach him through the contact form on his official website.
If you want to contact Ricardo Delgado, refer to La Quinta Columna or send him an e-mail to tutoronline@hotmail.es
Remember that Orwell City is not affiliated with La Quinta Columna. This is a website dedicated to gathering important information that this team of researchers delivers (and also from the many others from the Spanish-speaking world who are doing a great job in unmasking the plandemic). Orwell City summarizes, transcribes, translates, edits and subtitules videos so that everyone can learn about the shocking discovery they have made about the true content of the vaccination vials.
If you like my articles and the videos you find here and, if you can and feel like it, you can make a small donation. Your support is always more than appreciated.
Follow Orwell City on Telegram. Thank you for reading!
—Orwellito.
Sue (Ayt)
9th August 2021, 06:36
I happened upon this older (2015) paper in pubmed. It makes it sound like Graphene nanoparticles actually cause inflammation.
The Molecular Influence of Graphene and Graphene Oxide on the Immune System Under In Vitro and In Vivo Conditions
Abstract
Graphene and graphene oxide (GO), due to their physicochemical properties and biocompatibility, can be used as an innovative biomedical material in biodetection, drug distribution in the body, treating neoplasms, regenerative medicine, and in implant surgery. Research on the biomedical use of graphene and GO that has been carried out until now is very promising and shows that carbon nanomaterials present high biocompatibility. However, the intolerance of the immune system to graphene nanomaterials, however low, may in consequence make it impossible to use them in medicine. This paper shows the specific mechanism of the molecular influence of graphene and GO on macrophages and lymphocytes under in vitro and in vivo conditions and their practical application in medicine. Under in vitro conditions graphene and GO cause an increased production of pro-inflammatory cytokines, mainly IL-1, IL-6, IL-10 and TNF-α, as a result of the activation of Toll-like receptors in macrophages. Graphene activates apoptosis in macrophages through the TGFbr/Smad/Bcl-2 pathway and also through JNK kinases that are stimulated by an increase of ROS in the cell or through a signal received by Smad proteins. Under in vivo conditions, graphene nanomaterials induce the development of the local inflammatory reaction and the development of granulomas in parenchymal organs. However, there is a huge discrepancy between the results obtained by different research groups, which requires a detailed analysis. In this work we decided to collect and analyze existing research and tried to explain the discrepancies. Understanding the precise mechanism of how this nanomaterial influences immune system cells allows estimating the potential influence of grapheme and GO on the human body.
Keywords: Graphene; Graphene oxide; Immune cells; Inflammatory reaction.
https://pubmed.ncbi.nlm.nih.gov/26502273/
Journeyman
9th August 2021, 07:17
I happened upon this older (2015) paper in pubmed. It makes it sound like Graphene nanoparticles actually cause inflammation.
The Molecular Influence of Graphene and Graphene Oxide on the Immune System Under In Vitro and In Vivo Conditions
Abstract
Graphene and graphene oxide (GO), due to their physicochemical properties and biocompatibility, can be used as an innovative biomedical material in biodetection, drug distribution in the body, treating neoplasms, regenerative medicine, and in implant surgery. Research on the biomedical use of graphene and GO that has been carried out until now is very promising and shows that carbon nanomaterials present high biocompatibility. However, the intolerance of the immune system to graphene nanomaterials, however low, may in consequence make it impossible to use them in medicine. This paper shows the specific mechanism of the molecular influence of graphene and GO on macrophages and lymphocytes under in vitro and in vivo conditions and their practical application in medicine. Under in vitro conditions graphene and GO cause an increased production of pro-inflammatory cytokines, mainly IL-1, IL-6, IL-10 and TNF-α, as a result of the activation of Toll-like receptors in macrophages. Graphene activates apoptosis in macrophages through the TGFbr/Smad/Bcl-2 pathway and also through JNK kinases that are stimulated by an increase of ROS in the cell or through a signal received by Smad proteins. Under in vivo conditions, graphene nanomaterials induce the development of the local inflammatory reaction and the development of granulomas in parenchymal organs. However, there is a huge discrepancy between the results obtained by different research groups, which requires a detailed analysis. In this work we decided to collect and analyze existing research and tried to explain the discrepancies. Understanding the precise mechanism of how this nanomaterial influences immune system cells allows estimating the potential influence of grapheme and GO on the human body.
Keywords: Graphene; Graphene oxide; Immune cells; Inflammatory reaction.
https://pubmed.ncbi.nlm.nih.gov/26502273/
I wonder if you could overcome that immune response if you accustomed the immune system to the presence of graphene oxide by gradual exposure?
Say, over three doses rather than one?
melissanederland
9th August 2021, 18:28
Does anyone here have an English version of the Spanish research study that found the Phizer vaccine was 99% graphene or is it only available in Spanish? Thanks :)
Sérénité
9th August 2021, 22:20
I’m not sure how it could be 99% Graphene in the ‘vaccines’. I’m not great at science but wouldn’t that make the vials and syringe almost black and a bit like a snow globe of metal?
Maybe there is just enough in the vaccine for it to do what it’s needed to do once the recipient has had multiple shots?
Bill Ryan
9th August 2021, 22:43
I’m not sure how it could be 99% Graphene in the ‘vaccines’.Yep, there's something very wrong with that picture. 99% is impossible. There'd be no room for the spike proteins, which are known to do the damage.
See this video of Dr Ryan Cole, a pathologist who has expertise in immunology, virology and skin pathology.
He doesn't mention graphene at all, though it may very well be a harmful co-factor of some kind. In his very important presentation, Dr Cole explains the very serious spike protein damage, stating: “This is a poisonous attack on our population and it needs to stop now.”
9gAk4DJ2ot8Z
Gwin Ru
10th August 2021, 00:04
...
... I guess there is something lost in translation... what I understood is that, of the content that's in suspension in the vial solution, 99% of that non-liquid component is Graphene oxide and the remaining of that non-liquid content is 1% mRNA...
thepainterdoug
10th August 2021, 01:12
mellssanederland/ orwell city is the site that translates for la quinta columna from spanish to english
it shoud be in this archive https://www.orwell.city/p/archivo.html
Gwin Ru
10th August 2021, 01:37
...
... I guess there is something lost in translation... what I understood is that, of the content that's in suspension in the vial solution, 99% of that non-liquid component is Graphene oxide and the remaining of that non-liquid content is 1% mRNA...
This is where the translation got lost:
THE ACTUAL CONTENTS INSIDE PFIZER VIALS EXPOSED
7/7/21
https://forbiddenknowledgetv.net/the-actual-contents-inside-pfizer-vials-exposed/
"Dr Jane Ruby joins Stew Peters to discuss a scientific report that just came out from the University of Almería School of Engineering in Spain entitled, “Graphene Oxide Detection in Aqueous Suspension: Observational Study in Optical and Electron Microscopy”, where it was found that each dose of the Pfizer shot “was found to contain 6 ng of RNA and 747 ng of graphene oxide, which is 99.103% of the medication.
[...]
So... that's 753 ng total "solid" content... in aqueous suspension...
Delight
10th August 2021, 03:00
This is all a long time evolving to where we are positioned now in the frequency war. Starts off talking about magnetic fields and graphene etc.....
Dr Carrie Madej, Dr Judy Mikovits, Dr Robert O. Young | Multi-Pronged Attack On Human Health ❗❗❗📳
August 9th, 2021 (https://odysee.com/@RepentOrDieForever:e/Dr.-Madej-Dr.-Mikovits-Dr.-Young---Multi-Pronged-Attack-on-Human-Health:e)
watching now.... scary when one thinks too much
MIND MANIPULATION "BIRTH OF THE ZOMBIE
July 28th, 2021 (https://odysee.com/@Blackmarketnews:c/c5Yac.gaa:e)
onawah
10th August 2021, 03:42
WHY ARE THEY SO DESPERATE TO FORCE-INJECT US?
https://forbiddenknowledgetv.net/why-are-they-so-desperate-to-force-inject-us/
8/9/21
(rumble video at bottom of post)
https://rumble.com/vkwdan-why-are-they-so-desperate-to-force-inject-us.html
"A Big Tech/biotech whistleblower, who is concealing his true identity for now and going by “Liberty Man” has been working on a documentary series for Infowars and he joins Alex Jones to explain why the Globalists are so desperate to force-inject us and why we must educate ourselves as much as possible about this.
He says, “The reality is they’re deploying technology on us and if you don’t understand that technology, you will not understand what’s going on. If you’re a politician and you don’t understand the DARPA technology that’s being deployed on us right now, you are unfit to govern.
“We’re going to be digging into basically, what I think is the Rosetta Stone…It’s going to give you the perspective on why they’re pushing this stuff so hard. For the doctors and scientists out there, you’re going to understand all the vaccine injuries going on right now. But more importantly, you’re going to understand two key things of the agenda and why they’re pushing so hard; what this means to them…
TWO PARALLEL REVOLUTIONS AT PLAY
“To understand these shots, you need to understand that there are two parallel revolutions at play, from a technology perspective. There’s a biotech side to it and a nanotech side to it.”
He says the Antibody-Dependant Enhancement (ADE) and “pathogenic priming” side effects that we’ve seen – and where most of the focus has been in the independent news – this comes from the mRNA gene therapy and the biotech side of this operation.
What less people have been focusing on has been the graphene oxide. Readers of this blog already know about how researchers in Spain have been doing numerous analyses of the contents of the vials, including electron microscopy, spectroscopy and liquid chromatography and they were the first to announce that the injections contain a considerable dose of graphene oxide nanoparticles, making up over 99% of the “medication”. We also know, from Pfizer whistleblower, Karen Kingston that graphene oxide was redacted as an ingredient from Pfizer’s US patent, due to its status as a “trade secret”.
Liberty Man confirms that the “worms” seen on the masks and swabs and the magnetization effects of human bodies that we’ve been seeing are all examples of functionalized graphene.
Liberty Man asks, “How does the Hydrogel deliver the mRNA payload into our cells? The answer is graphene oxide,” which he says is also instrumental for their plan to make humans into nodes on the Internet of Things, as was first reported here in 2015 from the whistleblower pseudonymously-named “DJ” from Level9News, who described DoD patents, such as #3951134, “Distant Brain Reading and Brainwave Manipulation” [via satellite!] and #6011991 “Remote Brain-Computer Interface Neural Monitoring”, both of which relate to GeoINT and the JADE II software.
These relate to Agenda 2030 and the Smart Grids. He says, “They want to make you a part of the infrastructure of Smart Cities,” and Alex chimes in that Jeffrey Epstein was involved at every level of this.
He says that everyone loves to hate on Bill Gates but he suspects, after reading The Singularity is Near, that its author, Ray Kurzweil is the Technical Product Manager running the scientists in this whole operation, whereas Bill Gates was the Program Manager, managing the funding.
A NEW MANHATTAN PROJECT
“So again, why are they pushing so hard on all of this stuff?” he asks. “What Ray Kurzweil wants to do with nanotech, fundamentally is he wants to get in; he wants to get control of those [DNA] base pairs, he wants to own that cell. And to do that, he’s got to be able to…communicate with the DNA of that cell. And that’s what the nanotech’s all about…
“This is a new Manhattan Project that we’re going through, right now and it’s a big government…worldwide democide operation,” that has its theoretical roots back in the 1950s, when they mapped it all out. He says that we are the test subjects in what will become life-extension technologies for themselves.
Alex Jones agrees, saying that it’s about 1,000 times bigger than the Manhattan Project, with massive amounts of compartmentalization.
As for our current pandemic, Liberty Man says they began loading graphene oxide into the regular flu and other vaccines, back in 2017 and 2018. “[Graphene oxide] is how we can get them. This is the Crime Against Humanity, right here.”
He speculates that the Wuhan lab is where they worked on the synthetic spike protein. “That’s the biotech side. I also want to say that I think Dr Andrew Kaufman, Jon Rappaport, Thomas Cowan and others are vindicated about the no-isolation of the novel coronavirus…
“As a research community, we have not had a full grasp…and it’s allowing them to gain more ground. We’re losing ground. We can turn the tide, if we’re armed with the full truth. Then we have a fighting chance, here…
IT’S ABOUT TO GET “VERY REAL”
“OK, final points…there’s a team in Spain, there’s a team in Argentina; they’ve now shown that saline solution is loaded with graphene oxide…but we need a tidal wave of infowarriors to get out on this.”
He also refers to the unprecedented approval processes of drugs for neurodegenerative disease and he believes they are scrambling to take advantage of an upcoming vaxx-induced epidemic of these. Also, the first blood thinner product made for children, to protect them from blood clots was just released, again to take advantage of an imminent epidemic of blood clots in children.
He says it’s about to get “very real” and it will make the last year and a half look like a “walk in the park. We are weeks away from this thing going to the next level.”
If it feels like we’re living in a dystopian science fiction movie, this is due to all the predictive programming that has been relentlessly served up by the entertainment industry since the mid-20th century.
Like most of what the Globalists do, the COVID vaxx project has multiple purposes and two main motives are controlling you at the DNA level, which is something Elana Freeland has been talking about for years and which I’ve been posting here since 2015 and the other is to use us as their guinea pigs for their own life-extension purposes."
via75d/
Bill Ryan
10th August 2021, 07:36
WHY ARE THEY SO DESPERATE TO FORCE-INJECT US?
https://forbiddenknowledgetv.net/why-are-they-so-desperate-to-force-inject-us/
8/9/21
(rumble video at bottom of post)
https://rumble.com/vkwdan-why-are-they-so-desperate-to-force-inject-us.html
"A Big Tech/biotech whistleblower, who is concealing his true identity for now and going by “Liberty Man” has been working on a documentary series for Infowars and he joins Alex Jones to explain why the Globalists are so desperate to force-inject us and why we must educate ourselves as much as possible about this.
He says, “The reality is they’re deploying technology on us and if you don’t understand that technology, you will not understand what’s going on. If you’re a politician and you don’t understand the DARPA technology that’s being deployed on us right now, you are unfit to govern.
“We’re going to be digging into basically, what I think is the Rosetta Stone…It’s going to give you the perspective on why they’re pushing this stuff so hard. For the doctors and scientists out there, you’re going to understand all the vaccine injuries going on right now. But more importantly, you’re going to understand two key things of the agenda and why they’re pushing so hard; what this means to them…
TWO PARALLEL REVOLUTIONS AT PLAY
“To understand these shots, you need to understand that there are two parallel revolutions at play, from a technology perspective. There’s a biotech side to it and a nanotech side to it.”
He says the Antibody-Dependant Enhancement (ADE) and “pathogenic priming” side effects that we’ve seen – and where most of the focus has been in the independent news – this comes from the mRNA gene therapy and the biotech side of this operation.
What less people have been focusing on has been the graphene oxide. Readers of this blog already know about how researchers in Spain have been doing numerous analyses of the contents of the vials, including electron microscopy, spectroscopy and liquid chromatography and they were the first to announce that the injections contain a considerable dose of graphene oxide nanoparticles, making up over 99% of the “medication”. We also know, from Pfizer whistleblower, Karen Kingston that graphene oxide was redacted as an ingredient from Pfizer’s US patent, due to its status as a “trade secret”.
Liberty Man confirms that the “worms” seen on the masks and swabs and the magnetization effects of human bodies that we’ve been seeing are all examples of functionalized graphene.
Liberty Man asks, “How does the Hydrogel deliver the mRNA payload into our cells? The answer is graphene oxide,” which he says is also instrumental for their plan to make humans into nodes on the Internet of Things, as was first reported here in 2015 from the whistleblower pseudonymously-named “DJ” from Level9News, who described DoD patents, such as #3951134, “Distant Brain Reading and Brainwave Manipulation” [via satellite!] and #6011991 “Remote Brain-Computer Interface Neural Monitoring”, both of which relate to GeoINT and the JADE II software.
These relate to Agenda 2030 and the Smart Grids. He says, “They want to make you a part of the infrastructure of Smart Cities,” and Alex chimes in that Jeffrey Epstein was involved at every level of this.
He says that everyone loves to hate on Bill Gates but he suspects, after reading The Singularity is Near, that its author, Ray Kurzweil is the Technical Product Manager running the scientists in this whole operation, whereas Bill Gates was the Program Manager, managing the funding.
A NEW MANHATTAN PROJECT
“So again, why are they pushing so hard on all of this stuff?” he asks. “What Ray Kurzweil wants to do with nanotech, fundamentally is he wants to get in; he wants to get control of those [DNA] base pairs, he wants to own that cell. And to do that, he’s got to be able to…communicate with the DNA of that cell. And that’s what the nanotech’s all about…
“This is a new Manhattan Project that we’re going through, right now and it’s a big government…worldwide democide operation,” that has its theoretical roots back in the 1950s, when they mapped it all out. He says that we are the test subjects in what will become life-extension technologies for themselves.
Alex Jones agrees, saying that it’s about 1,000 times bigger than the Manhattan Project, with massive amounts of compartmentalization.
As for our current pandemic, Liberty Man says they began loading graphene oxide into the regular flu and other vaccines, back in 2017 and 2018. “[Graphene oxide] is how we can get them. This is the Crime Against Humanity, right here.”
He speculates that the Wuhan lab is where they worked on the synthetic spike protein. “That’s the biotech side. I also want to say that I think Dr Andrew Kaufman, Jon Rappaport, Thomas Cowan and others are vindicated about the no-isolation of the novel coronavirus…
“As a research community, we have not had a full grasp…and it’s allowing them to gain more ground. We’re losing ground. We can turn the tide, if we’re armed with the full truth. Then we have a fighting chance, here…
IT’S ABOUT TO GET “VERY REAL”
“OK, final points…there’s a team in Spain, there’s a team in Argentina; they’ve now shown that saline solution is loaded with graphene oxide…but we need a tidal wave of infowarriors to get out on this.”
He also refers to the unprecedented approval processes of drugs for neurodegenerative disease and he believes they are scrambling to take advantage of an upcoming vaxx-induced epidemic of these. Also, the first blood thinner product made for children, to protect them from blood clots was just released, again to take advantage of an imminent epidemic of blood clots in children.
He says it’s about to get “very real” and it will make the last year and a half look like a “walk in the park. We are weeks away from this thing going to the next level.”
If it feels like we’re living in a dystopian science fiction movie, this is due to all the predictive programming that has been relentlessly served up by the entertainment industry since the mid-20th century.
Like most of what the Globalists do, the COVID vaxx project has multiple purposes and two main motives are controlling you at the DNA level, which is something Elana Freeland has been talking about for years and which I’ve been posting here since 2015 and the other is to use us as their guinea pigs for their own life-extension purposes."
via75d/
:bump:
Many thanks, and this was important and very helpful. Bulletpoints:
LISTEN CAREFULLY to the video. Don't watch it. The visuals are interesting, but they're often unconnected and distracting.
"Liberty Man" (not John Moore: that's another liberty man) explains things well. In his words, it's a witch's brew of biotech AND nanotech.
He offers explanations for some of the anomalies and apparent contradictions (which had puzzled me as well). ADE (Antibody Dependent Enhancement) is very real — many people getting sick or worse from the 'vaccine' — but it's the not the only thing going on.
My additional thought: we're still missing an explanation for how come so many highly qualified doctors and scientists seem blind to what's happening. More sci-fi here (which the "Liberty Man" alludes to several times), but there does seem to be a degree of blanket mind control from an unknown source. Personally, though off-topic on this thread, I find myself continually thinking that in addition to all the above there may be an ET agenda built into all this.
Gwin Ru
10th August 2021, 12:23
...
... remember:
https://projectavalon.net/forum4/images/misc/quote_icon.png Posted by Gwin Ru (here) (https://projectavalon.net/forum4/showthread.php?p=1438659#post1438659)
http://ww3.hdnux.com/photos/11/04/50/2378250/9/628x471.jpg (http://www.sfgate.com/business/article/Cal-physicists-make-a-radio-10-000-times-thinner-3235246.php#next)
Nanotube radio (2007) (https://projectavalon.net/forum4/showthread.php?115576-Graphene-in-the-vaccines&p=1438659&viewfull=1#post1438659). Photo courtesy of Zettl Research Group, Lawrence Berkeley National Laboratory and University of California at Berkeley
... increase the frequency... that reduces the antenna length needed for reception...
So, in other words, humans have just become an App to their I-Phones, IoT, etc....
Gwin Ru
10th August 2021, 12:48
[...].... Personally, though off-topic on this thread, I find myself continually thinking that in addition to all the above there may be an ET agenda built into all this.
[/LIST]
Check this post (https://projectavalon.net/forum4/showthread.php?110454-The-Virus-the-Energetic-Viewpoint&p=1445211&viewfull=1#post1445211) with an interview with Greg Caton (apparently, he lives 10,000 ft up in the Ecuadorian Andes...).
Tintin
10th August 2021, 14:05
...
... I guess there is something lost in translation... what I understood is that, of the content that's in suspension in the vial solution, 99% of that non-liquid component is Graphene oxide and the remaining of that non-liquid content is 1% mRNA...
This is where the translation got lost:
THE ACTUAL CONTENTS INSIDE PFIZER VIALS EXPOSED
7/7/21
https://forbiddenknowledgetv.net/the-actual-contents-inside-pfizer-vials-exposed/
"Dr Jane Ruby joins Stew Peters to discuss a scientific report that just came out from the University of Almería School of Engineering in Spain entitled, “Graphene Oxide Detection in Aqueous Suspension: Observational Study in Optical and Electron Microscopy”, where it was found that each dose of the Pfizer shot “was found to contain 6 ng of RNA and 747 ng of graphene oxide, which is 99.103% of the medication.
[...]
So... that's 753 ng total "solid" content... in aqueous suspension...
I have an idea that given that not all the vaccines (sic) are the study intervention (treatment) that maybe in the placebo it's possible there is a greater concentration (of graphene oxide)? (Some of these multi-millions of injections are the placebo of course.) :sherlock:
Gwin Ru
10th August 2021, 14:26
TESTS CONFIRM VAXX MAGNETISM - (La Quinta Columna) (https://rumble.com/vkuqt6-tests-confirm-vaxx-magnetism-la-quinta-columna.html?mref=6zof&mrefc=5) 03:50
NewsParadigm
(https://rumble.com/c/c-335885)Published August 7, 2021
Rumble (https://rumble.com/) — Ricardo at La Quinta Columna uses instruments to demonstrate the magnetism in a man who had received the Covid-19 injection.
Graphene Oxide is a super-conducter and has been identified as an unlisted ingredient in the Covid-19 gene therapy inoculation by claiming the formula is "proprietary". The secrecy was never challenged by the FDA before they approved the ingredients for "Emergency Use Authorization" (EUA). This negligence by the FDA makes it impossible to provide "INFORMED CONSENT" to the patient.
The mechanism that explains the magnetic effect was submitted by Andrew Goldsworthy, PhD - https://justpaste.it/535li
Also, see "MAGNETIC COVID VACCINE DISORDER - Role of GRAPHENE OXIDE" - https://justpaste.it/2srra
vi8knw
Philippe
10th August 2021, 20:52
Does anyone here have an English version of the Spanish research study that found the Phizer vaccine was 99% graphene or is it only available in Spanish? Thanks :)
I saw this today. Best regards
https://www.notonthebeeb.co.uk/post/englis-translation-of-the-graphene-oxide-almeria-paper?utm_campaign=702bcd82-0ab1-45bd-9394-ce1c6f6e53bc&utm_source=so&utm_medium=mail&cid=e58f2905-55d9-4ee0-8d59-3c6772ae0641
Dorjezigzag
11th August 2021, 02:00
Not sure if this has already been shared but this is a video from 5 years ago, about Cellular Responses to Graphene Oxide Sheets.
Dr. Sandra Vranic, Nanomedicine Lab, Faculty of Medical & Human Sciences & National Graphene Institute, University of Manchester, Manchester (UK)
_kAevCpFNW0
thepainterdoug
11th August 2021, 12:15
heres the latest and most bizarre from La Quinta translated by Orwell city. Enter; a graphene world.
https://www.orwell.city/2021/08/graphene-and-reset.html
Delight
11th August 2021, 16:10
TESTS CONFIRM VAXX MAGNETISM - (La Quinta Columna) (https://rumble.com/vkuqt6-tests-confirm-vaxx-magnetism-la-quinta-columna.html?mref=6zof&mrefc=5) 03:50
NewsParadigm
(https://rumble.com/c/c-335885)Published August 7, 2021
Rumble (https://rumble.com/) — Ricardo at La Quinta Columna uses instruments to demonstrate the magnetism in a man who had received the Covid-19 injection.
Graphene Oxide is a super-conducter and has been identified as an unlisted ingredient in the Covid-19 gene therapy inoculation by claiming the formula is "proprietary". The secrecy was never challenged by the FDA before they approved the ingredients for "Emergency Use Authorization" (EUA). This negligence by the FDA makes it impossible to provide "INFORMED CONSENT" to the patient.
The mechanism that explains the magnetic effect was submitted by Andrew Goldsworthy, PhD - https://justpaste.it/535li
Also, see "MAGNETIC COVID VACCINE DISORDER - Role of GRAPHENE OXIDE" - https://justpaste.it/2srra
vi8knw
This video is about how to remove graphene.... not sure if it was posted before?
coABvwDVWwYg
Dorjezigzag
11th August 2021, 17:42
Graphene Oxide Interactions with Innate Immune Cells; Neutrophil Biodegradation and Inflammasome Activation
Prof. Dr. Bengt Fadeel, Research group leader, Nanosafety & Nanomedicine Laboratory, Division of Molecular Toxicology, Institute of Environmental Medicine, Karolinska Institutet, Stockholm, (S)
Immunogenicity Toxicity and Safety of Nanoparticles
2nYvS11NDRc
Dorjezigzag
13th August 2021, 19:15
This video asks
Why graphene hasn’t taken over the world...yet
well if the studies of various scientists are true it already has in a quite stealthy way.
This video is quite good to understand more about its properties. It's funny to consider it is a form of carbon that has been made the bogeyman by the elites.
IesIsKMjB4Y
Gwin Ru
14th August 2021, 15:04
The Right Side with Doug Billings - August 13, 2021 (https://rumble.com/vl3vfd-the-right-side-with-doug-billings-august-13-2021.html) 1:00:10
The Right Side with Doug Billings (https://rumble.com/c/DougBillings)
Published August 13, 2021
Rumble (https://rumble.com/) — Karen Kingston discusses her response to fact-checkers.
vihpa3
Check the reference documents here: https://dougbillings.us/karen-kingston/#Slidedecks
thepainterdoug
17th August 2021, 21:27
Another update from La Quinta by Orwell
This is a warning regarding pregnant women//
In program 109 of La Quinta Columna, Dr. José Luis Sevillano and biostatistician Ricardo Delgado dedicated part of their time to read and analyze the study entitled 'Potential adverse effects of nanoparticles on the reproductive system.'
Dr. Sevillano has concluded that, most probably, the graphene oxide contained in the vaccines is altering the production of hormones at the hypothalamus-pituitary level. This is something very serious since it could cause developmental problems in the unborn child and even infertility.
Orwell City offers in English the key moments of the reading and discussion of the article in question.
Link: Rumble
Ricardo Delgado: Look, this is one of the studies that we have uploaded in La Quinta Columna. It's one of them. It talks about... It says, 'Potential adverse effects of nanoparticles on the reproductive system.'
Source: Dovepress
'Substantial attention has been paid to the potential risks of NPs. Previous studies have shown that numerous types of NPs are able to pass certain biological barriers and exert toxic effects on crucial organs, such as the brain, liver, and kidney. Only recently, attention has been directed toward the reproductive toxicity of nanomaterials. NPs can pass through the blood-testis barrier, placental barrier, and epithelial barrier, which protect reproductive tissues, and then accumulate in reproductive organs. NP accumulation damages organs (testis, epididymis, ovary, and uterus) by destroying Sertoli cells.'
These must be some cells and involved in reproduction, I understand.
'Leydig cells, and germ cells, causing reproductive organ dysfunction that adversely affects sperm quality, quantity, morphology, and motility or reduces the number of mature oocytes and disrupts primary and secondary follicular development. In addition, NPs can disrupt the levels of secreted hormones...'
Here you have the... Here it is, José Luis. The toxicity of graphene oxide in nanoparticle format generates alterations in the hormonal system also in women. Therefore, they're going to have hormonal imbalances.
'...causing changes in sexual behavior. However, the current review primarily examines toxicological phenomena.'
In other words, it doesn't focus much on the other.
'The molecular mechanisms involved in NP toxicity to the reproductive system are not fully understood, but possible mechanisms include oxidative stress —we know this—, apoptosis, inflammation, and genotoxicity. Previous studies have shown that NPs can increase inflammation, oxidative stress, and apoptosis and induce ROS, causing damage at the molecular and genetic levels which results in cytotoxicity.'
Well, the study is much more complete.
Dr. Sevillano: See if it mentions anything about the brain. The hormone issue of that part, because this sounds like a rapid, global derangement. Like it's commanded from the brain.
The pituitary gland makes these hormones. And the nanoparticles are known to get into the brain. So, these nanoparticles and start to destroy all the usual balance. And that's why the menses are more painful or more abundant. All these hormones, LH, HCF, come from the brain. And, surely, from there they are screwing up the whole balance of the cycle completely.
Ricardo Delgado: Look here. 'As they do...'
Dr. Sevillano: Prolactin has an influence.
Ricardo Delgado: 'As they do in males, NPs can also cause an imbalance of sex hormones in females.' It's crystal clear.
Dr. Sevillano: Exactly.
Ricardo Delgado: 'In females, sex hormones maintain the reproductive cycle, which is crucial for the female reproductive system.' Logically. 'The imbalance of sex hormones induced by NPs might affect fertility.'
Ricardo Delgado: These would also affect sexual behavior.
Dr. Sevillano: Yes, it ****s you alive. To put it in a nutshell. That's what we're saying. If the menstrual cycles are altered, it's because the intoxication is at the brain level. This doesn't act, probably, in the ovary or in the uterus. All these are changes in the brain, at the level of the hypophysis. In the axis that orders everything up there and all its hormones, the same ones described there. HCF, LH, prolactin... All those hormones arise from there. They're known to get wrecked by getting that stuff in there. Nanoparticles. All those tissues are very well irrigated. They're very well irrigated. And if the particles get directly in there where these hormones are made, it completely destroys the normal balance. That's where the problems arise.
Ricardo Delgado: As in any other study, when we look at the toxicology of graphene oxide, depleted glutathione comes up. They found elevated levels of MDA.' I don't know what it's right now. It may be a radical, I guess.
Dr. Sevillano: M...
Ricardo Delgado: MDA. Look, here's the abbreviation. MDA is... Well, I don't know. Is it malondialdehyde? I don't know. It's an amino acid, it looks like.
Dr. Sevillano: I guess it's a compound to check out. What else does it say?
Ricardo Delgado: 'GSH depletion,' which is glutathione. 'Depletion of glutathione, catalase,' which were enzymes, too.
Dr. Sevillano: Yes.
Ricardo Delgado: 'And superoxide dismutase, which indicates the occurrence of oxidative stress'. Which is what COVID generates. Let's see if we learn this already.
Dr. Sevillano: We already know, at the end of the article, where all these problems that this girl (from the video) and all the women we're seeing with the COVID issue have with menstruation are born.
Have you seen where it all comes from? From the brain. Everything is altered up there. We don't need to look for the origin in the ovary, or in the uterus, or in the endometrium, or anything else. The problem originates in the brain. Everything gets out of control in the brain. That's the origin.
That's why I wondered: 'Why does it happen that the breasts swell, that menstruation stops? What does all this mean?' Well, it originates from an imbalance in the brain. There are too many things that are telling us that there's a hormone regulation problem there. Notice how we have found that the toxicity at these levels comes from the hypothalamic-pituitary axis. It promotes the secretion of hormones in the ovaries. But what is in the brain is what commands, and from there, they are already altered.
Ricardo Delgado: José Luis, apart from that of whether the hormonal development is altered, the development of a child is being altered as well. Probably. So...
Dr. Sevillano: Probably... Well, what it's going to cause is infertility. Almost certainly. At the moment. Because we see weird cycles come and go. High prolactin, other hormones are low. I mean, it's a mess. How're you going to get pregnant with hormones like that?
I mean, it's better not to get pregnant. If you're intoxicated with that, it's better not to take the risk. Because we still don't see, we don't know what's going to happen to the children of the people who have become graphenated. That hasn't been said yet. Fauci just tells us that if nothing happens in the first 40 days, nothing happens and that we just vaccinate everybody. I mean, what about the children? When these children develop in the body of a graphenated woman, how're they going to be born? Are they going to be born healthy? Are they going to have any defects? I mean, you can imagine that it can't be good.
Remember that Orwell City is not affiliated with La Quinta Columna. This is a website dedicated to gathering important information that this team of researchers delivers (and also from the many others from the Spanish-speaking world who are doing a great job in unmasking the plandemic).
Orwell City summarizes, transcribes, translates, edits and subtitules videos so that everyone can learn about the shocking discovery they have made about the true content of the vaccination vials.
If you like my articles and the videos you find here and, if you can and feel like it, you can make a small donation. Your support is always more than appreciated.
Follow Orwell City on Telegram. Thank you for reading!
—Orwellito.
ExomatrixTV
17th August 2021, 22:29
Graphene Oxide Nanoparticles (https://www.facebook.com/100021748577524/videos/147756070821239/)
147756070821239
source (https://www.facebook.com/100021748577524/videos/147756070821239/)
Arcturian108
21st August 2021, 11:28
This video touts the benefits of graphene on our food:
http://www.youtube.com/watch?v=oaaHLu77pQc&feature=share
Open Minded Dude
27th August 2021, 20:52
Meanwhile in Japan ...
https://www.naturalnews.com/2021-08-27-japan-discovers-magnetic-substance-in-pfizer-covid-vaccines-journalists-start-dying.html#
https://asia.nikkei.com/Spotlight/Coronavirus/COVID-vaccines/1.6m-Moderna-doses-withdrawn-in-Japan-over-contamination
Gwin Ru
29th August 2021, 12:10
Moderna vaccinations halted in Japan’s Okinawa after ‘black substances’ found in vial, days after other batch of jab was suspended (https://www.rt.com/news/533369-okinawa-moderna-vaccination-suspended-contaminants-japan/)
RT
29 Aug, 2021 08:33
Get short URL (https://on.rt.com/bfjt)
https://cdni.rt.com/files/2021.08/xxs/612b2d7185f5407da9534d71.jpg
© AFP / HAZEM BADER
Okinawa prefecture has halted Moderna vaccinations after unknown materials were found in a vial of the drug. The move comes after Japan pulled 1.6 million Moderna doses from a different batch over contamination concerns.
Black substances were discovered in syringes and a vial, while unidentified pink substances were spotted in a different syringe with a Moderna vaccine dose, according to Japan’s public broadcaster, NHK.
Okinawa’s government said in a statement on Sunday that it was suspending the use of Moderna vaccines after “foreign substances were spotted in some of them.”
Takeda Pharmaceutical, Japan’s domestic distributor of the Moderna shot, is expected to probe whether the suspected contamination occurred during production and will consult with the health ministry on the matter, NHK reported.
The discovery comes just three days after Japan suspended the use of more than 1.6 million Moderna doses that had been distributed to 863 vaccination centers around the country. The doses were temporarily pulled from circulation as a precautionary measure after foreign material was discovered in some vials. Some of the doses were reportedly contaminated with metal particles. The newly discovered contaminated doses in Okinawa are from different vaccine lots.
While the issue is still being investigated, Japan’s Health Ministry revealed on Saturday that two people who had received their second Moderna doses from the vaccine lots withdrawn earlier this week had died. The ministry said it was investigating what killed the two victims, both men in their 30s, and that it was currently unknown if the vaccine played a role.
The vials from the pulled batches, which were manufactured by a Moderna contractor in Europe, are currently undergoing laboratory analysis. The results will be available early next week, Moderna and Takeda said in a joint statement released on Saturday.
On Friday, Taro Kono, the minister in charge of Japan’s immunization campaign, disclosed that more than 500,000 vaccinations had already been carried out using the doses from the vaccine lots in question. So far, there doesn’t appear to be any “serious safety issues” identified, Kono said.
The European Medicines Agency (EMA) has launched its own probe to determine if the EU’s Moderna supply suffers from similar contamination problems.
Related:
2 people die in Japan after receiving Moderna Covid-19 shots from batch that was withdrawn due to foreign material in some vials (https://www.rt.com/news/533323-japan-moderna-vaccination-deaths/)
Bubu
30th August 2021, 12:37
https://www.facebook.com/100071095665686/videos/556367945412403
Gwin Ru
30th August 2021, 13:58
Scanning & Transmission Electron Microscopy Reveals Graphene Oxide in CoV-19 Vaccines (https://www.drrobertyoung.com/post/transmission-electron-microscopy-reveals-graphene-oxide-in-cov-19-vaccines)
Updated: 5 hours ago
2021, August 20
Author: Robert O Young CPC, MSc, DSc, PhD, Naturopathic Practitioner
www.drrberyoung.com
Phase Contrast Microscopy, Transmission and Scanning Electron Microscopy and Energy-Dispersive X-ray Spectroscopy Reveal the Ingredients in the CoV-19 Vaccines!
https://static.wixstatic.com/media/fbbf2b_acf6a99ad5be43e5a78d81ba4a2d3df5~mv2.png/v1/fill/w_740,h_359,al_c,q_95/fbbf2b_acf6a99ad5be43e5a78d81ba4a2d3df5~mv2.webp (https://www.drrobertyoung.com/blog/search/germs)
Germs Are Born In Us and From Us as an Outfection and NOT an Infection of the Body Cells. In other words germs are symptoms of cellular and genetic disorganization and NOT the specific cause of the cellular and genetic disorganization! The GERM is NOTHING and the TERRAIN is EVERYTHING . Germs can only contribute to a state of toxic imbalance but NEVER cause ANY specific sickness or disease![55] - Dr. Robert O. Young (https://www.drrobertyoung.com/blog/search/germs)
Abstract
Currently there are four major pharmaceutical companies who manufacture a SARS-CoV-2 now called SARS-CoV-19 vaccine. These manufactures and their vaccine are Pfizer--BioNTech mRNA Vaccine, the Moderna-Lonza mRNA-1273 Vaccine, the Serum Institute Oxford Astrazeneca Vaccine and the Janssen COVID -19 Vaccine, manufactured by Janssen Biotech Inc., a Janssen Pharmaceutical Company of Johnson & Johnson, a recombinant, replication-incompetent adenovirus type 26 expressing the SARS-CoV-2 spike protein. The intended purpose of these vaccines are to provide immunity from the so-called infectious novel coronavirus or SARS-CoV - 2 virus now called the SARS-CoV - 19. These four pharmaceutical companies have not provided complete FDA disclosure on their vaccine box, insert fact sheet or label for many of the major and/or minor ingredients contained within these so-called vaccines. The purpose of this research article is to identify those specific major and minor ingredients contained in the Pfizer Vaccine, the Moderna Vaccine, the Astrazeneca Vaccine and the Janssen Vaccine using various scientific anatomical, physiological and functional testing for each SARS-COV-2-19 vaccine. As a human right, governed under World Law by the Nuremberg Code of 1947, the vaccine specific ingredient information is critical, required and necessary to know so that any human from any country in the World can make an informed decision whether or not to consent to the SAR-CoV-2-19 inoculation. We have conducted the scientific testing on each vaccine and have identified several ingredients or adjuvants that have not been disclosed which are contained in these four SARS-CoV - 2 -19 vaccines. Currently, these vaccines are being administered to millions of humans around the World under an Emergency Use Authorization (EUA) issued by each country without full disclosure of all ingredients and in some cases mandated by governments or employers in violation of individual human rights under the Nuremberg Code of 1947.
Methodology and Techniques
Four “vaccines” were analyzed which are the Pfizer-BioNtech, Moderna-Lonza mRNA-1273 Vaccine, Vaxzevria by Astrazeneca, Janssen by Johnson & Johnson, using different instrumentation and protocols of preparation according to new nano particulate technological approaches. The different instrumentation includes Optical Microscopy, Bright-Field Microscopy, pHase Contrast Microscopy, Dark-Field Microscopy, UV absorbance and Fluorescence Spectroscopy, Scanning Electron Microscopy, Transmission Electron Microscopy, Energy Dispersive Spectroscopy, X-ray Diffractometer, Nuclear Magnetic Resonance instruments were used to verify the “vaccines” morphologies and contents. For the high-technology measurements and the care of the investigation, all the controls were activated and reference measurements adopted in order to obtain validated results.
Live Blood Phase Contrast and Dark-Field Microscopy
Images of the aqueous fractions of the vaccines were subsequently obtained to visually assess the possible presence of carbon particulates or graphene.
The observations under optical microscopy revealed and abundance of transparent 2D laminar objects that show great similarity with images from literature (Xu et al, 2019), and with images obtained from rGO standard (SIGMA)(Figures 1, 2 and 3).
Images of big transparent sheets of variable size and shapes were obtained, showing corrugated and flat, irregular. Smaller sheets of polygonal shapes, also similar to flakes described in literature (Xu et al, 2019) can be revealed with pHase Contrast and Dark-Field microscopy (Figure 3).
All these laminar objects were widespread in the aqueous fraction of the blood (Figure 1) or vaccine sample (Figures 2 and 3) and no component described by the registered patent can be associated with these sheets.
In Figure 1 You Can See What A Cluster Bomb of Reduced Graphene Oxide (rGO) Looks Like in the Live Unstained Human Blood after a CoV-19 Inoculation Causing Pathological Blood Coagulation![1][2][55][56][57]
https://static.wixstatic.com/media/fbbf2b_7ddf1a00d004487782b64a1f15a3aa27~mv2.png/v1/fill/w_740,h_548,al_c,q_95/fbbf2b_7ddf1a00d004487782b64a1f15a3aa27~mv2.webp (https://www.drrobertyoung.com/post/what-causes-oxygen-deprivation)
Figure 1 is a Micrograph of a Carbon Cluster of Reduced Graphene Oxide (rGO) Viewed in the Live Unstained Human Blood with pHase Contrast Microscopy at 1500x. Note that the Red Blood Cells are Clotting in and Around the rGO Crystal in a Condition Known as Rouleau! A French Word Which Means to Chain. (https://www.drrobertyoung.com/post/what-causes-oxygen-deprivation)
What Are the Non-Disclosed Ingredients Contained in CoV - 19 So-Called Pfizer, Moderna, Astrazeneca and Janssen Vaccines?
To answer this question an aqueous fraction of the Pfizer, Moderna, Astrazeneca and Janssen vaccines were taken from each vile and then viewed separately under pHase Contrast Microscopy at 100x, 600x up to1500x magnification showing anatomical evidence of reduced Graphene Oxide (rGO) particulates which were compared to micrographs of rGO from Choucair et al, 2009 for identification and verification.[3]
Steps of Analysis of Vaccine Aqueous Fractions
Refrigerated samples were processed under sterile conditions, using laminar flow chamber and sterilized lab ware.
Steps for analyses were:
1. Dilution in 0.9% sterile physiological saline (0.45 ml + 1.2 ml)
2. Polarity fractionation: 1.2 ml hexane + 120 ul of RD1 sample
3. Extraction of hydrophilic aqueous pHase
4. UV absorbance and fluorescence spectroscopy scanning
https://static.wixstatic.com/media/fbbf2b_f634f46ae6e84db5861152d7a2a07965~mv2.png/v1/fill/w_740,h_433,al_c,q_95/fbbf2b_f634f46ae6e84db5861152d7a2a07965~mv2.webp
5. Extraction and quantification of RNA in the sample
6. Electron and optical microscopy of aqueous pHase
The Pfizer "Vaccine" Non-disclosed Ingredients
The micrographs in Figures 2 and 3 were obtained using 100X, 600X and 1500X pHase Contrast, Dark Field and Bright Field Optical Microscopy.[3]
On the left of each micrograph you will view micrographs obtained from the Pfizer vaccine aqueous fraction containing rGO.
On the right of each micrograph ou will view a match from known sources containing rGO for anatomical validation.
The observations under a pHase Contrast, Dark-Field, Bright-Field microscopy, Transmission and Scanning Electron microscopy of the vaccine product by Pfizer, including vaccine products of Moderna, Astrazeneca and Janssen revealed some entities that can be graphene strips as seen below in Figure 3.
https://static.wixstatic.com/media/fbbf2b_acdddb2995cd472ba6ddc5283bf48949~mv2.png/v1/fill/w_740,h_275,al_c,q_95/fbbf2b_acdddb2995cd472ba6ddc5283bf48949~mv2.webp
Figure 2 shows an aqueous fraction image from Pfizer vaccine sample (left) and from reduced graphene oxide (rGO) standard (right) (Sigma-777684). Optical microscopy, 100X
https://static.wixstatic.com/media/fbbf2b_aacb78604f3b49bb8ea147ba94b23195~mv2.png/v1/fill/w_740,h_565,al_c,q_95/fbbf2b_aacb78604f3b49bb8ea147ba94b23195~mv2.webp
Figure 3 - Aqueous fraction images containing reduced graphene oxide from Pfizer vaccine sample (left) and sonicated reduced graphene oxide (rGO) standard (right) (Sigma-777684). Optical pHase contrast microscopy, 600X. In addition, the Muestra RD1, La Quinta Columna Report, June 28, 2021; Graphene Oxide Detection in Aqueous Suspension; Delgado Martin, Campra Madrid confirms our findings. [4]
https://static.wixstatic.com/media/fbbf2b_9c37c1bfdad34160bf04352134342e26~mv2.png/v1/fill/w_740,h_504,al_c,q_95/fbbf2b_9c37c1bfdad34160bf04352134342e26~mv2.webp
Figure 4 shows the liposome Capsid containing rGO that Pfizer uses for its product to vehiculate the graphene oxide by attaching the Liposome capsid to specific mRNA molecules for driving the Liposome contents of fGO to specific organs, glands and tissues, namely the ovaries and testes, bone marrow, heart and brain. The image was obtained by a SEM-Cryo preparation.
For a definitive identification of graphene by TEM, it is necessary to complement the observation with the structural characterization by obtaining a characteristic electron diffraction standard sample (as the figure 'b' shown below).[4]
The standard sample corresponding to graphite or graphene has a hexagonal symmetry, and generally has several concentric hexagons.
https://static.wixstatic.com/media/fbbf2b_573b8c4faf674889a067b1828405b103~mv2.png/v1/fill/w_740,h_305,al_c,q_95/fbbf2b_573b8c4faf674889a067b1828405b103~mv2.webp
Figure 4b Reveals X ray Diffraction Pattern of the Graphene Particles. [4]
Using Transmission Electron Microscopy (TEM) we observed an intricate matrix or mesh of folded translucent flexible rGO sheets with a mixture of darker multilayer agglomerations and lighter colored of unfolded monolayers as seen in Figure 5. [3][4]
https://static.wixstatic.com/media/fbbf2b_1d24923a402d491cab65d7654d442e88~mv2.png/v1/fill/w_740,h_547,al_c,q_95/fbbf2b_1d24923a402d491cab65d7654d442e88~mv2.webp
Figure 5 shows a cluster of graphene nanoparticles in a Pfizer vaccine. They appear to be aggregated.
The darker linear areas in Figure 5 appear to be local overlap of sheets and local arrangement of individual sheets in parallel to the electron beam.[5]
After the mesh, a high density of unidentified rounded and elliptical clear shapes appears, possibly corresponding to holes generated by mechanical forcing of the rGO mesh during treatment as seen in Figure 6.[4][5]
https://static.wixstatic.com/media/fbbf2b_e8418f44ce284c55b40469d2b9fe3ff1~mv2.png/v1/fill/w_740,h_246,al_c,q_95/fbbf2b_e8418f44ce284c55b40469d2b9fe3ff1~mv2.webp
Figure 6 shows a TEM microscopy observation where particles of reduced graphene oxide in a Pfizer” vaccine” are present. The X-ray diffractometry reveals their nature of crystalline Carbon-based nanoparticles of rGO. This evidence was intitially found by Muestra RD1, and published in the La Quinta Columna Report, June 28, 2021; Graphene Oxide Detection in Aqueous Suspension; Delgado Martin, Campra Madrid. [4]
The Immune Response to Dietary, Metabolic, Environmental and Inoculated Organic and Inorganic Micro and Nano Particulates
The bright orange blood crystal below is solidified uric acid from the ingestion of a high protein diet from animal flesh, blood and interstitial fluids. You will note that there are several neutrophils attempting to clean-up and remove this toxic mass. This is the main purpse of white blood cells to manage and maintain the delicale pH of balance of the bod fluids.
yKONi_hDsfE
As you watch the video above you view two neutrophils (neutrophils make up 2/3rds of the total white blood count) swimming through the blood plasma. The neutrophil from the left is moving downward to pick up a biological transformation of a Y-form yeast, like Candida albicans.
This is the main function of neutrophils to pick up organic and non-organic micro and nano particulates, such as graphene oxide as seen in the micrograph below labeled GO and the neutrophil labeled NET. The neutrophil is attempting to pick up and remove the graphene oxide, a toxic acidic poison which is contained in all CoV - 2 - 19 so-called vaccines!
https://static.wixstatic.com/media/fbbf2b_373e02806ffa44dd9197f8ce1d7e5c2d~mv2.png/v1/fill/w_740,h_744,al_c,q_95/fbbf2b_373e02806ffa44dd9197f8ce1d7e5c2d~mv2.webp
The micrograph above is showing the graphene oxide (GO) and the poisoning and destruction of the neutrophils (NET - which make up over 60 percent of all white blood cells) which are designed to pick up and eliminate foreign toxic chemical waste and biologicals.
Energy-Dispersive X-ray Spectroscopy Reveals rGO in Pfizer Vaccine[5][6][7]
The Pfizer vaccine liquid fraction was then analyzed for chemical and elemental content using Energy-dispersive X-ray spectroscopy (EDS) as seen in Figure 6. The EDS spectrum showed the presence of Carbon, Oxygen verifying the rGO elements and Sodium and Chloride since the sample shown in Figures 2, 3, 5,and 6 were diluted in a saline solution.
https://static.wixstatic.com/media/fbbf2b_95e1e01cef48405898a2451af9b28ce7~mv2.png/v1/fill/w_740,h_278,al_c,q_95/fbbf2b_95e1e01cef48405898a2451af9b28ce7~mv2.webp
Figure 7 shows an EDS spectrum of a Pfizer “vaccine” under an ESEM microscopy coupled with an EDS x-ray microprobe (X axis =KeV, Y axis = Counts) identifying Carbon, Oxygen, Sodium and Chloride
The Quantification of mRNA in the Pfizer Vaccine
The quantification of RNA in the Pfizer sample was carried out with conventional protocols (Fisher).
According to NanoDropTM 2000 spectrophotometer calibration check specific software (Thermofisher), the UV absorption spectrum of total aqueous fraction was correlated to 747 ng/ul of unknown absorbing substances.
However, after RNA extraction with commercial kit (Thermofisher), quantification with RNA specific Qbit fluorescence probe (Thermofisher) showed that only 6t ug/ul could be related to the presence of RNA. The spectrum was compatible with the peak of rGO at 270nm.
According to microscopic images presented here, most of this absorbance might be due to graphene-like sheets, abundant in the fluids suspension in the sample.
The conclusions are further supported by high fluorescence from the sample with maximum at 340 nm, in accordance with peak values for rGO. It must be reminded that RNA does not show spontaneous fluorescence under UV exposure.
https://static.wixstatic.com/media/fbbf2b_61ff08edb96942ddb1e76d7b21be8c97~mv2.png/v1/fill/w_740,h_429,al_c,q_95/fbbf2b_61ff08edb96942ddb1e76d7b21be8c97~mv2.webp
Figure 8 - UV spectrum of aqueous fraction of Pfizer vaccine sample.[1][2][3][5][6]
Ultra Violet Fluorescence Testing of the Pfizer Aqueous Fraction for Reduced Graphene Oxide (rGO)[6]
Ultra Violet absorption and fluorescence spectra were obtained with Cytation 5 Cell Imaging Multi-Mode Reader Spectrophotometer (BioteK). UV absorbance spectrum confirmed a maximum peak at 270nm, compatible with presence of rGO particulate.
UV fluorescence maximum at 340 nm also suggests presence of significant amounts of rGO in the sample (Bano et al, 2019).
https://static.wixstatic.com/media/fbbf2b_c708016d104c4a41a4a2516c6599d1a8~mv2.png/v1/fill/w_740,h_353,al_c,q_95/fbbf2b_c708016d104c4a41a4a2516c6599d1a8~mv2.webp
Figure 9 - UV absorption and fluorescence spectra were obtained with Cytation 5 Cell Imaging Multi-Mode Reader Spectrophotometer (BioteK). UV absorbance spectrum confirmed a maximum peak at 270 nm, compatible with presence of rGO. UV fluorescence maximum at 340 nm also suggests presence of significant amounts of rGO in the sample (Bano et al, 2019).
https://static.wixstatic.com/media/fbbf2b_35a5b27b3e48495399c55809d316dd54~mv2.png/v1/fill/w_740,h_373,al_c,q_95/fbbf2b_35a5b27b3e48495399c55809d316dd54~mv2.webp
Figure 10 - The spectroscopy UV analysis showed an adsorption due to the presence of reduced graphene oxide, which is confirmed by observation under ultraviolet visible microscopy.
Figures 11 and 12 below shows a micrograph of different micro and nano particulates which have been identified in the Pfizer, Moderna, Astrazeneca and Janssen, so-called “vaccines” and analyzed under an Environmental Scanning Electron Microscope (SEM) coupled with an x-ray microprobe of an Energy Dispersive System (EDS) that reveals the particle size, composition distribution (https://rtilab.com/analytical-services/particle-analysis/)and chemical nature of the observed micro and nano particulates under observation.[6][7][8]
https://static.wixstatic.com/media/fbbf2b_d89760ebddf74c4dbdcfda2d7648a1a1~mv2.png/v1/fill/w_740,h_511,al_c,q_95/fbbf2b_d89760ebddf74c4dbdcfda2d7648a1a1~mv2.webp
Figure 11 shows sharp micron debris of 20 um in length identified in the Pfizer so-called “vaccine” containing Carbon, Oxygen Chromium, Sulphur, Aluminum, Chloride, Nitrogen.
https://static.wixstatic.com/media/fbbf2b_c5534127ea5b49df8333ba2375ee2abc~mv2.png/v1/fill/w_740,h_253,al_c,q_95/fbbf2b_c5534127ea5b49df8333ba2375ee2abc~mv2.webp
Figure 12 shows a 20 micron in length particulate identified in the so-called Pfizer “vaccine”. It is composed of carbon, oxygen chromium, sulphur, aluminum, chloride and nitrogen.
Figures 13 and 14 below shows a micrograph of different micro and nano particulates which have been identified in the Pfizer, Moderna, Astrazeneca and Janssen, so-called “vaccines” and analyzed under an Environmental Scanning Electron Microscope (SEM) coupled with an x-ray microprobe of an Energy Dispersive System (EDS) that reveals the particle size, composition distribution (https://rtilab.com/analytical-services/particle-analysis/)and chemical nature of the observed micro and nano particulates under observation.
Are There Parasites in the Pfizer "Vaccines"?
A 50 micron elongated body, as seen in Figure 13 is a sharp mysterious presence in the Pfizer vaccine. It appears and is identified anatomically as a Trypanosoma cruzi parasite of which several variants are lethal and is one of many causes of acquired immune deficiency syndrome or AIDS.[Atlas of Human Parasitology, 4th Edition, Lawrence Ash and Thomas Orithel, pages 174 to 178][9]
https://static.wixstatic.com/media/fbbf2b_1d1c4b6f9aae43158158363afaf576c2~mv2.png/v1/fill/w_740,h_514,al_c,q_95/fbbf2b_1d1c4b6f9aae43158158363afaf576c2~mv2.webp
Figure 13 shows a Trypanosoma Parasite approximately 20 microns in length found in the so-called Pfizer “vaccine”. It is composed of carbon, oxygen chromium, sulphur, aluminum, chloride and nitrogen.
https://static.wixstatic.com/media/fbbf2b_afefe13d4e5f4c77bfe0d056275a5cc6~mv2.png/v1/fill/w_740,h_424,al_c,q_95/fbbf2b_afefe13d4e5f4c77bfe0d056275a5cc6~mv2.webp
A Live Blood pHase Contrast Microscopy Micrograph of Trypanosoma cruzi Parasite[9]
... continued below...
Gwin Ru
30th August 2021, 13:59
...
... continued from above...
Figure 14 identifies a composition of nano particulates including carbon, oxygen chromium, sulphur, aluminum, chloride and nitrogen also found in the CoV-19 "vaccines."
https://static.wixstatic.com/media/fbbf2b_98586d7b0e3a4743af78599822bfb7c8~mv2.png/v1/fill/w_740,h_267,al_c,q_95/fbbf2b_98586d7b0e3a4743af78599822bfb7c8~mv2.webp
Figure 13 Identifies a Composite of Nano particulates
Figures 15 and 16 below show a micrograph of different micro and nano particulates which have been identified and analyzed under an Environmental Scanning Electron Microscope (SEM) coupled with an x-ray microprobe of an Energy Dispersive System (EDS) that reveals the chemical nature of the observed micro and nano particulates and their morphology.
The white 2-micron-long particulate is composed of bismuth, carbon, oxygen, aluminum, sodium, copper and nitrogen.
https://static.wixstatic.com/media/fbbf2b_06d27086502b43eb9a1ee9e361942cea~mv2.png/v1/fill/w_740,h_529,al_c,q_95/fbbf2b_06d27086502b43eb9a1ee9e361942cea~mv2.webp
Figure 15 shows nano and micron particulates identified in the Pfizer “vaccine”. The white 2 micron long particulate is composed of bismuth, carbon, oxygen, aluminum, sodium, copper and nitrogen.
https://static.wixstatic.com/media/fbbf2b_ecf365857e7248dab67e99f6cf52d500~mv2.png/v1/fill/w_740,h_263,al_c,q_95/fbbf2b_ecf365857e7248dab67e99f6cf52d500~mv2.webp
Figure 16 shows that the white 2 micron particulate found in the so-called Pfizer 'vaccine' is composed of bismuth, carbon, oxygen, aluminum, sodium, copper and nitrogen.
Figures 17 and 18 show the identification of organic carbon, oxygen and nitrogen particulates with an aggregate of embedded nanoparticles including bismuth, titanium, vanadium, iron, copper, silicon and aluminum which were all found in the so-called Pfizer “vaccine.”
https://static.wixstatic.com/media/fbbf2b_29504020339040e286e10783ca30454e~mv2.png/v1/fill/w_740,h_507,al_c,q_95/fbbf2b_29504020339040e286e10783ca30454e~mv2.webp
Figure 17 - shows an organic (Carbon-Oxygen-Nitrogen) aggregate with embedded nanoparticles of bismuth, titanium. vanadium. iron, copper, silicon, aluminum embedded in Pfizer “vaccine!”
https://static.wixstatic.com/media/fbbf2b_8359dc515afe4002bc30556d0ea53c9d~mv2.png/v1/fill/w_740,h_261,al_c,q_95/fbbf2b_8359dc515afe4002bc30556d0ea53c9d~mv2.webp
Figure 18 - shows an organic (Carbon-Oxygen-Nitrogen) aggregate with embedded nanoparticles of bismuth, titanium. vanadium. iron, copper, silicon, aluminum embedded in Pfizer “vaccine!”
The Astrazeneca "Vaccine" Non-disclosed Ingredients
Figures 19 and 20 show an engineered aggregate of iron, chromium and nickel also known as stainless steel of micro and nano particles embedded and identified in the Astrazeneca “vaccine” viewed under Transmission Electron Microscopy (TEM) and quantified with an x-ray microprobe of an Energy Dispersive System that reveals the chemical nature of the observed micro and nano particulates and their morphology.
https://static.wixstatic.com/media/fbbf2b_08600fbaec8b4b138596bf5192c827fc~mv2.png/v1/fill/w_740,h_386,al_c,q_95/fbbf2b_08600fbaec8b4b138596bf5192c827fc~mv2.webp
Figure 19 - Engineered aggregate of iron, chromium and nickel also know as stainless steel.
https://static.wixstatic.com/media/fbbf2b_27abe03d21164cd5aec9a15b4dc17e4c~mv2.png/v1/fill/w_740,h_273,al_c,q_95/fbbf2b_27abe03d21164cd5aec9a15b4dc17e4c~mv2.webp
Figure 20 shows the quantified namo particulates in the Astrazeneca "vaccine" with an x-ray microprobe of an Energy Dispersive System that reveals the chemical nature of the observed micro and nano particulates.
Using the XRF (X-ray fluorescence) instrument was used to evaluate the adjuvants in the Astrazeneca "vaccine", which identified the following molecules of histidine, sucrose, Poly-ethylene glycol (PEG) and ethylene alcohol, also contained in the Pfizer and Moderna "vaccines". The results of this test can be seen in Figure 20.[10]
The injection of PEG and Ethylene alcohol are both known as carcinogenic and genotoxic.[10] PEG was the only adjuvant declared on the data sheet listing the ingredients of the Astrazeneca “vaccine” but contained in the Pfizer and Moderna "vaccines".
https://static.wixstatic.com/media/fbbf2b_581cbca5d2054643af12b92f7686cd05~mv2.png/v1/fill/w_740,h_471,al_c,q_95/fbbf2b_581cbca5d2054643af12b92f7686cd05~mv2.webp
Figure 21 Identifies the Spectrum of AstraZeneca Vaccine Adjuvants. Different colors are used for the four molecules identified by means of reference spectra. Relative concentration is calculated on integrals of reference signals for molecules in a quantitative spectrum acquired with a duty cycle of 5 seconds with the longest calculated T1 was 5sec.
The Janssen "Vaccine" Non-Disclosed Ingredients
Figures 22 and 23 shows an organic-inorganic aggregate identified in the Janssen “vaccine”. The particles are composed of stainless steel and are glued together with a “Carbon-based glue” of reduced graphene oxide.[11] This aggregate is highly magnetic and can trigger pathological blood coagulation and "The Corona Effect" or "The Spike Protein Effect" creation from the degeneration of the cell membrane due to interactions with other dipoles.[11] You can view these biological reactions or cellular transformations in the live blood under pHase Contrast and Dark Field Microscopy in Figures 24, 25 and 26.[1][12]
https://static.wixstatic.com/media/fbbf2b_e479101d3b4d45f58299b87dfd770c52~mv2.png/v1/fill/w_740,h_505,al_c,q_95/fbbf2b_e479101d3b4d45f58299b87dfd770c52~mv2.webp
Figure 22 A Stainless Steel Aggregation of Carbon , Oxygen, Iron and Nickel Held Together With Graphene Oxide
https://static.wixstatic.com/media/fbbf2b_807325cf954c45ea8afc3e38c4e08a4c~mv2.png/v1/fill/w_740,h_260,al_c,q_95/fbbf2b_807325cf954c45ea8afc3e38c4e08a4c~mv2.webp
Figure 23 Shows Elements of of Carbon , Oxygen, Iron and Nickel Held Together With Graphene Oxide.
The Corona Effect and Spike Protein Effect
The Endogenously Created "Corona Effect" and "Spike Protein" ARE Caused by Chemical and Radiation Poisoning from Reduced Graphene Oxide and Microwave Radiation![12]
https://static.wixstatic.com/media/fbbf2b_7e99806301ef4892acc528defe02e155~mv2.png/v1/fill/w_740,h_510,al_c,q_95/fbbf2b_7e99806301ef4892acc528defe02e155~mv2.webp (https://www.drrobertyoung.com/post/what-causes-oxygen-deprivation)
Figure 24 "The Corona Effect" and the Endogenous Creation of Exosomes Due to Chemical and Radiation Poisoning of the Vascular and the Interstitial fluids of the Interstitium (https://www.drrobertyoung.com/post/what-causes-oxygen-deprivation)
https://static.wixstatic.com/media/fbbf2b_d247b00e72b646e8a92b8215b7362144~mv2.png/v1/fill/w_740,h_487,al_c,q_95/fbbf2b_d247b00e72b646e8a92b8215b7362144~mv2.webp (https://www.drrobertyoung.com/post/what-causes-oxygen-deprivation)
Figure 25 Shows "The Corona Effect" and the the Endogenous Birth of S1 Protein Spikes Caused by Radiation and Chemical Poisoning or What I Call The "Protein Spiking Effect" (https://www.drrobertyoung.com/post/what-causes-oxygen-deprivation)
https://static.wixstatic.com/media/fbbf2b_e906bd834d334c6a950a8341885a246a~mv2.png/v1/fill/w_740,h_498,al_c,q_95/fbbf2b_e906bd834d334c6a950a8341885a246a~mv2.webp
Figure 26 This Micrograph Shows the Endogenous Creation of the "Spike Protein" as an Outfection and NOT and Infection!
Figures 24 and 25 above show 'The CORONA EFFECT' on the red blood cells with Figure 26 showing 'The SPIKED PROTEIN EFFECT' both caused by decompensated acidosis of the interstitial and then vascular fluids from an acidic lifestyle and specifically, exposure to toxic pulsating electro-magnetic fields at 2.4gHz or higher, chemical poisoning from the food and water ingested, toxic acidic air pollution, chem-trails and to top-it-all-off a nana particulate chemical laden CoV - 19 inoculation! Please check your feelings and false beliefs at the door before YOU prematurely cause YOURSELF harm![12]
The Moderna "Vaccine" Non-Disclosed Ingredients
Figure 26 and 27 identified a mixed entity of organic and inorganic matter contained in the Moderna “vaccine."
Transmission Electron Microscopy (TMS) and quantified with an x-ray microprobe of an Energy Dispersive System (EDS) revealed the chemical nature of the observed micro and nano particulates.
The so-called Moderna "vaccine' is a carbon-based Reduced Graphene Oxide substrate where some nanoparticles are embedded. The nanoparticles are composed of carbon, nitrogen, oxygen, aluminum, copper, iron and chlorine.[13]
https://static.wixstatic.com/media/fbbf2b_7d5f645d8abb4bb3bd8a065633740af0~mv2.png/v1/fill/w_740,h_509,al_c,q_95/fbbf2b_7d5f645d8abb4bb3bd8a065633740af0~mv2.webp
Figure 26 Transmission Electron Microscopy Reveals a Graphene Oxide Composite of Embedded Organic and Non-Organic Matter
https://static.wixstatic.com/media/fbbf2b_3a70a5a029554a27bcc78fe717aab969~mv2.png/v1/fill/w_740,h_266,al_c,q_95/fbbf2b_3a70a5a029554a27bcc78fe717aab969~mv2.webp
Figure 27 Reveals Embedded Cytotoxic Nano Particulates
Figures 27 and 28 shows an analysis which was also performed under Transmission Electron Microscopy (TEM) and quantified with an x-ray microprobe of an Energy Dispersive System (EDS) and revealed the chemical nature of the observed micro and nano particulates. Many foreign bodies were identified with a spherical morphology with some bubble-shaped cavities.
Figure 29 shows they are composed of carbon, nitrogen, oxygen, silicon, lead, cadmium, and selenium. This highly toxic nano particulate composition are quantum dots of cadmium selenide which are cytotoxic and genotoxic.[14][15]
https://static.wixstatic.com/media/fbbf2b_8f8011a1cb7f4e279a7f346128d6ec69~mv2.png/v1/fill/w_740,h_505,al_c,q_95/fbbf2b_8f8011a1cb7f4e279a7f346128d6ec69~mv2.webp
Figure 27 Reveals the Nano Dots in the Graphene Oxide Found in the Moderna "Vaccine"
https://static.wixstatic.com/media/fbbf2b_f37054347e9d4c5c92eba2ef33fc5e7b~mv2.png/v1/fill/w_740,h_517,al_c,q_95/fbbf2b_f37054347e9d4c5c92eba2ef33fc5e7b~mv2.webp
Figure 28 Reveals the Nano Dots in the Graphene Oxide Found in the Moderna "Vaccine"
https://static.wixstatic.com/media/fbbf2b_da5f3415cf3e4c608462082c5c0bf858~mv2.png/v1/fill/w_740,h_263,al_c,q_95/fbbf2b_da5f3415cf3e4c608462082c5c0bf858~mv2.webp
Figure 29 Reveals the Cytotoxic and Genotoxic Composite of Nano Particulates in Graphene Oxide Found in the Moderna "Vaccine"
Figures 30 and 31 further analysis of the so-called Moderna “vaccine” showed a 100-micron symplast of reduced graphene oxide nano particulate composite. The rGO is composed of carbon and oxygen with contamination of nano particulates of nitrogen, silicon, phosphorus and chlorine Chlorine.[16]
https://static.wixstatic.com/media/fbbf2b_9b3eb7252098483a8ecd63cf7d7020b2~mv2.png/v1/fill/w_740,h_509,al_c,q_95/fbbf2b_9b3eb7252098483a8ecd63cf7d7020b2~mv2.webp
Figure 30 Transmission Electron Microscopy Reveals a Large 100 micron Symplast Composite of Reduces Graphene Oxide
https://static.wixstatic.com/media/fbbf2b_830082881bd34abfb6798df2c8292414~mv2.png/v1/fill/w_740,h_255,al_c,q_95/fbbf2b_830082881bd34abfb6798df2c8292414~mv2.webp
Figure 31 Reveals the Nano Particulate Complex Contained in the Moderna "Vaccine"
... continued below...
Gwin Ru
30th August 2021, 14:00
...
... continued from above...
Figures 32 and 33 show carbon-based reduced graphene oxdie entities in the Moderna “vaccine” mixed with aggregates filled with Aluminium silicate nanoparticulates.[17]
https://static.wixstatic.com/media/fbbf2b_5b7d083dfa5444afbf60a825b2d53cda~mv2.png/v1/fill/w_740,h_258,al_c,q_95/fbbf2b_5b7d083dfa5444afbf60a825b2d53cda~mv2.webp
Figure 32 Reveals a Complex of Graphene Oxide and Aluminium Silicate Using Transmission Electron Microscopy
https://static.wixstatic.com/media/fbbf2b_883b3b265a8847019691ce0ae0a27135~mv2.png/v1/fill/w_740,h_258,al_c,q_95/fbbf2b_883b3b265a8847019691ce0ae0a27135~mv2.webp
Figure 33 Reveals the Nano Elements of Graphene Oxide and Aluminum Silicate Contained in the Moderna "Vaccine"
Discussion
The SARS-CoVid-2-19 pandemic induced the pharmaceutical industries to develop new drugs that they called vaccines.
The mechanism of action of these new drugs as declared by the pharmaceutical industry coupled with what is reported in the vaccine products’ data sheet is NOT clear for current medical savants to understand that those new drugs produced by Pfizer--BioNTech mRNA Vaccine, the Moderna-Lonza mRNA-1273 Vaccine, the Serum Institute Oxford Astrazeneca Vaccine and the Janssen COVID -19 Vaccine, manufactured by Janssen Biotech Inc., a Janssen Pharmaceutical Company of Johnson & Johnson are NOT vaccines but nanotechnological drugs working as a genetic therapy.
The name “vaccine” is likely to be an escamotage (trickery) used for bureaucratic and technocratic reasons in order to receive an urgent approval, ignoring all the normal rules necessary for new drugs, especially for those involving novel nanotechnological mechanisms which have never been developed nor experienced by humans any where, at any time in the history of World.
All these so-called “vaccines” are patented and therefore their actual content is kept secret even to the buyers, who, of course, are using taxpayers' money. So, consumers (taxpayers) have no information about what they are receiving in their bodies by inoculation. Humanity is kept in the dark as far as the nano particulate technological processes involved are concerning, on the negative effects on the cells of the body, but mostly on the possible magneticotoxic, cytotoxic and genotoxic nano-bio-interaction effect on the blood and body cells.
This current research study via direct analysis on the aforementioned so-called “vaccines” by means of nano particulate technological instrumentation reveals disturbing and life-altering information concerning the truth about the actual toxic acidic contents of the so-called vaccines.
https://static.wixstatic.com/media/fbbf2b_4fc0a6702b3c492eb652ddc4093dda53~mv2.png/v1/fill/w_740,h_592,al_c,q_95/fbbf2b_4fc0a6702b3c492eb652ddc4093dda53~mv2.webp (https://www.drrobertyoung.com/post/vaxx-the-real-facts)
The Pfizer, Moderna, Astrazeneca and Janssen drugs are NOT "vaccines" but complexed Graphene Oxide nano particulate aggregates of varying nano elements attached to genetically modified nucleic acids of mRNA from animal or vero cells and aborted human fetal cells as viewed and described above. Once again the ingredients in these so-called vaccines are highly magneticotoxic, cytotoxic and genotoxic to plant, insect, bird, animal and human cell membranes and their genetics which already has lead to serious injuries (estimated at over 500 million) and/or eventual death (estimated at over 35 million).[17][18] through [55]
The so-called “experts” or "medical savants" are telling YOU that CoV -2 - 19 vaccines are the ONLY way to stop the spread of CoV-19... even when there is NO EVIDENCE of its existence and NO EVIDENCE of it spreading as determined by the scientific method of Koch or Rivers postulates![54]
https://static.wixstatic.com/media/fbbf2b_567ab3498078478a98b30d6f001a0c08~mv2.png/v1/fill/w_740,h_532,al_c,q_95/fbbf2b_567ab3498078478a98b30d6f001a0c08~mv2.webp (https://www.drrobertyoung.com/post/dismantling-the-viral-theory)
Dismantling the Viral Theory (https://www.drrobertyoung.com/post/dismantling-the-viral-theory)
That they’re safe — despite the documented evidence is to the contrary...[54]
That they’re effective — even though millions of “double-jabbed” people are getting sick, theoretically exposing themselves to a NON-EXISTENT VIRUS called CoV - 19, and dying…[55] NOT from some phantom viral infection but from the FEAR or false evidence appearing real and the toxic acid contents of reduced graphene oxide delivered via the genetically modified mRNA to specific targets of the human body leading to pathological blood coagulation, oxygen deprivation, hypercapnia, hypoxia and then death by suffocation.[56][57][58]
https://static.wixstatic.com/media/fbbf2b_6d9da0939cde4b99ab81aa6f7b7978ed~mv2.png/v1/fill/w_740,h_643,al_c,q_95/fbbf2b_6d9da0939cde4b99ab81aa6f7b7978ed~mv2.webp (http://www.drrobertyoung.com/blog)
Disseminated Intravascular Coagulation (DIC) or Pathological Blood Coagulation.[57][58] (http://www.drrobertyoung.com/blog)
That YOU MUST get at LEAST two shots PLUS “boosters” to live “normal lives”...
And soon, they’ll be telling YOU that YOU have no choice but to comply with ALL their MANdates even when the CDC and other Governments, Universities and Medical Institutes have admitted in writing that they have NO "GOLD STANDARD" isolation of the CoV - 2 now called CoV - 19 virus![55]
There is NO CORONA VIRUS and NEVER HAS BEEN![56]
Remember ...
DON’T LET ANYONE TAKE AWAY YOUR HEALTH FREEDOM!
It is YOUR Body, YOUR Life and YOUR Choice!
Knowledge is power. And it’s the key to understanding why the experimental CoV -19 vaccines are so dangerous — despite the corporate media’s official narrative that suppresses and censors anyone who dares to speak out.
You are in control of your own health. Don’t fall victim to global governments and bureaucrats that are pushing everyone to get vaccinated. Billionaire “philanthropist” Bill Gates and billionaire Big Tech activists think they know what’s best for you and your family.
You must be free to decide what’s right for you. Do NOT let governments and employers force you into getting "vaxxed" “for your own good”.
And never let the cancel culture make you too afraid to stand up for your rights!
In the words of the great French doctor and scientist, Antione BeChamp, "there is nothing so false that does NOT contain a element of truth and so it is with the germ theory." In this case the viral, vaccine and immunity theory![59]
https://static.wixstatic.com/media/fbbf2b_ff1a6eb498f646eca76fde80fc682cc5~mv2.png/v1/fill/w_740,h_574,al_c,q_95/fbbf2b_ff1a6eb498f646eca76fde80fc682cc5~mv2.webp (http://www.drrobertyoung.com/blog)
To learn more about viruses, vaccines and the viral theory please read and study, A Second Though About Viruses, Vaccines and the HIV AIDS Hypothesis. You can order this book at:
https://www.phmiracleproducts.com/collections/books-audio-video/products/second-thoughts-about-viruses-vaccines-and-the-hiv-aids-hypothesis-booklet (https://www.phmiracleproducts.com/collections/books-audio-video/products/second-thoughts-about-viruses-vaccines-and-the-hiv-aids-hypothesis-booklet)
https://static.wixstatic.com/media/fbbf2b_5f2e58a82698492f9a5613eb2e91b54f~mv2.jpg/v1/fill/w_740,h_1177,al_c,q_90/fbbf2b_5f2e58a82698492f9a5613eb2e91b54f~mv2.webp (https://www.phmiracleproducts.com/collections/books-audio-video/products/second-thoughts-about-viruses-vaccines-and-the-hiv-aids-hypothesis-booklet)
Read and Learn More About Viruses, Vaccines and the Viral Theory in the Following Scientific Articles!
https://static.wixstatic.com/media/fbbf2b_8faed9361b914aadb50970b5d56a6a20~mv2.jpg/v1/fill/w_210,h_280,al_c,lg_1,q_90/fbbf2b_8faed9361b914aadb50970b5d56a6a20~mv2.webp (http://www.drrobertyoung.com)
Robert O Young MSc, DSc, PhD, Naturopathic Practitioner (http://www.drrobertyoung.com)
1. Scanning & Transmission Electron Microscopy Results Revealing Graphene Oxide in CoV-19 Vaccines - An Interview with Dr. Robert O. Young.
Absolutely bombshell and major reveals on what is in the vaccines, with use of electron and other kinds of microscopy from original research by Dr. Robert Young and his team, confirming what the La Quinta Columna researchers found---toxic nanometallic content with cytotoxic and genotoxic effects as well as an identified parasite. This is major revelation: please stay tuned for a major article reporting this at ECC, meanwhile please share this video widely!
https://www.bitchute.com/video/Z2sAH0Woz38r/ (https://www.bitchute.com/video/Z2sAH0Woz38r/)
https://static.wixstatic.com/media/fbbf2b_c5212664d56d4227af8804827f117386~mv2.png/v1/fill/w_740,h_414,al_c,q_95/fbbf2b_c5212664d56d4227af8804827f117386~mv2.webp (https://www.bitchute.com/video/Z2sAH0Woz38r/)
https://rumble.com/vlonug-electron-microscopy-reveals-graphene-oxide-in-cov-19-vaccines.html
https://static.wixstatic.com/media/fbbf2b_25174b8629b347d7a0ac56a66d950871~mv2.png/v1/fill/w_602,h_199,al_c,lg_1,q_95/fbbf2b_25174b8629b347d7a0ac56a66d950871~mv2.webp (https://rumble.com/vlonug-electron-microscopy-reveals-graphene-oxide-in-cov-19-vaccines.html)
https://odysee.com/@DrRobertYoung:7/MicroscopyEvidenceofGOinVaccineszoom_0:c?r=DwWt6qy5ACY9nSS1q6nAqSpAYbuZDjWf
2. The Epidemic Curves of the Most Vaccinated Countries https://www.drrobertyoung.com/post/world-health-organization-who-publishes-epidemic-curves-of-the-most-vaccinated-countries (https://www.drrobertyoung.com/post/world-health-organization-who-publishes-epidemic-curves-of-the-most-vaccinated-countries)
3. Sweden Is Following the Biological Science NOT the Political Sciencehttps://www.drrobertyoung.com/post/sweden-is-following-the-biological-science-not-the-political-science
4. What is Happening in India https://www.drrobertyoung.com/post/what-happened-in-india (https://www.drrobertyoung.com/post/what-happened-in-india)
5. Surviving the Plague of Corruption https://www.drrobertyoung.com/post/surviving-the-plague-of-corruption (https://www.drrobertyoung.com/post/surviving-the-plague-of-corruption)
6. Dismantling the Viral Theory https://www.drrobertyoung.com/post/dismantling-the-viral-theory (https://www.drrobertyoung.com/post/dismantling-the-viral-theory)
7. Corona on Trial https://www.drrobertyoung.com/post/corona-on-trial-explosive-and-exclusive (https://www.drrobertyoung.com/post/corona-on-trial-explosive-and-exclusive)
8. The Havana Cuba Syndrome Caused by Directed Pulsating EMF Microwaves https://www.drrobertyoung.com/post/the-havana-syndrome-pulsating-microwaves
https://static.wixstatic.com/media/fbbf2b_a13f5d07592643d89081abb681a33539~mv2.png/v1/fill/w_740,h_441,al_c,q_95/fbbf2b_a13f5d07592643d89081abb681a33539~mv2.webp (https://www.drrobertyoung.com/post/the-havana-syndrome-pulsating-microwaves)
9. CDC NOW Admits NO 'Gold Standard' for the Isolation for ANY Virus! - https://www.drrobertyoung.com/post/cdc-now-admits-no-gold-standard-for-the-isolation-for-any-virus?postId=60c4dbc74f7fc9002ba2507e (https://www.drrobertyoung.com/post/cdc-now-admits-no-gold-standard-for-the-isolation-for-any-virus?postId=60c4dbc74f7fc9002ba2507e)
https://static.wixstatic.com/media/fbbf2b_416361a68a0c44548ba0744336475db8~mv2.png/v1/fill/w_740,h_913,al_c,q_95/fbbf2b_416361a68a0c44548ba0744336475db8~mv2.webp (https://www.drrobertyoung.com/post/cdc-now-admits-no-gold-standard-for-the-isolation-for-any-virus?postId=60c4dbc74f7fc9002ba2507e)
10. Freedom of Information Responses on CoV - 2 Now Called CoV - 19 - https://www.drrobertyoung.com/post/freedom-of-information-responses-on-cov-2 (https://www.drrobertyoung.com/post/freedom-of-information-responses-on-cov-2)
11. Why Viruses Do Not Exist! - https://www.drrobertyoung.com/post/why-viruses-do-not-exist (https://www.drrobertyoung.com/post/why-viruses-do-not-exist)
https://static.wixstatic.com/media/fbbf2b_3f5352d7eac44d87b625368d5b52c0ab~mv2.png/v1/fill/w_740,h_463,al_c,lg_1,q_95/fbbf2b_3f5352d7eac44d87b625368d5b52c0ab~mv2.webp (https://rumble.com/vldnuw-the-governments-of-the-world-have-lied-to-all-of-us-concerning-cov-19-part-.html)
12. Report 255 | Dr. Robert Young: All Disease is Outfection Not Infection--Vaccine Nano is Bioweapon! https://www.bitchute.com/video/rdQhuY455VmK (https://www.bitchute.com/video/rdQhuY455VmK/)
13. Report 255 | Dr. Robert Young: All Disease is Outfection, not Infection | The Vaccine's Lipid Nanoparticles with Graphene Plus Radiation is the Bioweapon--No COVID Virus Exists!
https://www.brighteon.com/250210af-c8a3-47a1-8922-c960342fe2fb
14. Report 255 | Dr. Robert Young: All Disease is Outfection Not Infection--Vaccine Nano is Bioweapon!
https://odysee.com/@RamolaDReports:8/Report-255---Dr.-Robert-Young-Explains-Disease-by-Outfection,-Lipid-Nanoparticles-with-Graphene-the:4 (https://odysee.com/@RamolaDReports:8/Report-255---Dr.-Robert-Young-Explains-Disease-by-Outfection,-Lipid-Nanoparticles-with-Graphene-the:4)
15. Forget Everything Else! Look at THE VAER's NUMBERS on Injuries and Deaths! https://www.drrobertyoung.com/post/forget-everything-else-you-ve-heard-just-look-at-the-numbers (https://www.drrobertyoung.com/post/forget-everything-else-you-ve-heard-just-look-at-the-numbers)
https://static.wixstatic.com/media/fbbf2b_d25c3287196c46a6a1a588abd93ba9d8~mv2.png/v1/fill/w_740,h_565,al_c,q_95/fbbf2b_d25c3287196c46a6a1a588abd93ba9d8~mv2.webp (https://www.drrobertyoung.com/post/forget-everything-else-you-ve-heard-just-look-at-the-numbers)
16. Dr. Robert O. Young ITNJ Testimony
Sign up for Dr. Young's FREE Newsletter NOW at: wwwdrrobertyoung.com
References:
[1] Ou, L., Song, B., Liang, H. et al. Toxicity of graphene-family nanoparticles: a general review of the origins and mechanisms. Part Fibre Toxicol13, 57 (2016). https://doi.org/10.1186/s12989-016-0168-y (https://doi.org/10.1186/s12989-016-0168-y)
[2] Young RO (2016) Pathological Blood Coagulation and the Mycotoxic Oxidative Stress Test (MOST). Int J Vaccines Vaccin 2(6): 00048. DOI: 10.15406/ijvv.2016.02.00048 (https://doi.org/10.15406/ijvv.2016.02.00048)
[3] Xu et al, (2019) Identification of graphene oxide and its structural features in solvents by optical microscopy, RSC Adv., 9, 18559-18564
1-Extracction RNA Kit https://www.fishersci.es/shop/products/ambion-purelink-rna-mini-kit7/10307963
2- NanoDrop™ https://www.thermofisher.com/order/catalog/product/ND-2000#/ND-2000
3- QUBIT2.0: https://www.thermofisher.com/es/es/home/references/newsletters-andjournals/bioprobes-journal-of-cell-biology-applications/bioprobes-issues-2011/bioprobes-64-april2011/the-qubit-2-0-fluorometer-april-2011.html (https://www.thermofisher.com/es/es/home/references/newsletters-andjournals/bioprobes-journal-of-cell-biology-applications/bioprobes-issues-2011/bioprobes-64-april2011/the-qubit-2-0-fluorometer-april-2011.html)
[4] Muestra RD1, La Quinta Columna Report, June 28, 2021; Graphene Oxide Detection in Aqueous Suspension; Delgado Martin, Campra Madrid.
[5] Kim et al, Seeing graphene-based sheets, Materials Today,Volume 13, Issue 3,2010,Pages 28- 38,ISSN 1369-7021,https://doi.org/10.1016/S1369-7021(10)70031-6
[6] Bano, I. et al , 2019. Exploring the fluorescence properties of reduced graphene oxide with tunable device performance,Diamond and Related Materials,Volume 94,59-64,ISSN 0925- 9635,https://doi.org/10.1016/j.diamond.2019.02.021.
[7] Biroju, Ravi & Narayanan, Tharangattu & Vineesh, Thazhe Veettil. (2018). New advances in 2D electrochemistry—Catalysis and Sensing. 10.1201/9781315152042-7.
[8] Choucair, M., Thordarson, P. & Stride, J. Gram-scale production of graphene based on solvothermal synthesis and sonication. Nature Nanotech 4, 30–33 (2009). https://doi.org/10.1038/nnano.2008.365
[9] Atlas of Human Parasitology, 4th Edition, Lawrence Ash and Thomas Orithel, pages 174 to 178
[10] Mano, S.S.; Kanehira, K.; Sonezaki, S.; Taniguchi, A. Effect of Polyethylene Glycol Modification of TiO2 Nanoparticles on Cytotoxicity and Gene Expressions in Human Cell Lines. Int. J. Mol. Sci.2012, 13, 3703-3717. https://doi.org/10.3390/ijms13033703 (https://doi.org/10.3390/ijms13033703)
[11] Srivastava AK, Dwivedi N, Dhand C, et al. Potential of graphene-based materials to combat COVID-19: properties, perspectives, and prospects. Mater Today Chem. 2020;18:100385. doi:10.1016/j.mtchem.2020.100385
[12] Young, RO, "The Effects of ElectroMagnetic Frequencies (EMF) on the Blood and Biological Terrain." https://www.drrobertyoung.com/post/the-effects-electromagnet-frequencies-on-the-blood-and-biological-terrain (https://www.drrobertyoung.com/post/the-effects-electromagnet-frequencies-on-the-blood-and-biological-terrain)
[13] Gatti AM, Manti A, Valentini L, Montanari S, Gobbi P, et al. (2016) Nano biointeraction of particulate matter in the blood circulation. Frontiers 30: 3.
[14] Nikazar, S., Sivasankarapillai, V.S., Rahdar, A. et al. Revisiting the cytotoxicity of quantum dots: an in-depth overview. Biophys Rev 12, 703–718 (2020). https://doi.org/10.1007/s12551-020-00653-0
[15] Ritesh Banerjee, Priya Goswami, Manoswini Chakrabarti, Debolina Chakraborty, Amitava Mukherjee, Anita Mukherjee, Cadmium selenide (CdSe) quantum dots cause genotoxicity and oxidative stress in Allium cepa plants, Mutation Research/Genetic Toxicology and Environmental Mutagenesis, Volume 865, 2021, 503338,ISSN 1383-5718, https://doi.org/10.1016/j.mrgentox.2021.503338. (https://doi.org/10.1016/j.mrgentox.2021.503338)
[16] Wanjun Cao, Lin He, Weidong Cao, Xiaobing Huang, Kun Jia, Jingying Dai, Recent progress of graphene oxide as a potential vaccine carrier and adjuvant, Acta Biomaterialia, Volume 112, 2020, Pages 14-28, ISSN 1742-7061, https://doi.org/10.1016/j.actbio.2020.06.009. (https://doi.org/10.1016/j.actbio.2020.06.009) (https://www.sciencedirect.com/science/article/pii/S1742706120303305) (https://www.sciencedirect.com/science/article/pii/S1742706120303305)
[17] Concise Encyclopedia of Composite Materials, ed. Anthony Kelly, MIT Press, 1989, ISBN (https://en.wikipedia.org/wiki/ISBN_(identifier))0-262-11145-4 (https://en.wikipedia.org/wiki/Special:BookSources/0-262-11145-4)
[18] L. Harivardhan Reddy, José L. Arias, Julien Nicolas, and Patrick Couvreur, "Magnetic Nanoparticles: Design and Characterization, Toxicity and Biocompatibility, Pharmaceutical and Biomedical Applications." Chemical Reviews 2012 112 (11), 5818-5878 DOI: 10.1021/cr300068p
[19] US Dpt of health and human services (1996) Report Update: Vaccine Side Effects, Adverse Reactions, Contraindications, and Precautions. CDC 45(RR-12): 1-35.
[20] Ottaviani G, Lavezzi AM, Matturri L (2006) Sudden infant death syndrome (SIDS) shortly after hexavalent vaccination: pathology in suspected SIDS? Virchows Arch 448(1): 100-104.
[21] Taylor B, Miller E, Farrington CP, Petropoulos MC, Favot-Mayaud I, et al. (1999) Autism and measles, mumps, and rubella vaccine: no epidemiological evidence for a causal association. Lancet 353(9169): 2026-2029.
[22] Demicheli V, Rivetti A, Debalini MG, Di Pietrantonj C (2012) Vaccines for measles, mumps and rubella in children. Cochrane Database Syst Rev 15(2): CD004407. New Quality-Control Investigations on Vaccines: Micro- and Nanocontamination 13/13 Copyright: ©2016 Gatti et al. Citation: Gatti AM, Montanari S (2016) New Quality-Control Investigations on Vaccines: Micro- and Nanocontamination. Int J Vaccines Vaccin 4(1): 00072. DOI: 10.15406/ijvv.2017.04.00072
[23] Carola Bardage, Ingemar Persson, Åke Örtqvist, Ulf Bergman, Jonas F Ludvigsson, et al. (2011) Neurological and autoimmune disorders after vaccination against pandemic influenza A (H1N1) with a monovalent adjuvanted vaccine: population based cohort study in Stockholm, Sweden. BMJ 343: d5956.
[24] Johann Liang R (2012) Updating the Vaccine Injury Table following the 2011 IOM Report on Adverse Effects of vaccines. HRSA, pp. 1-27.
[25] L Tomljenovic, CA Shaw (2011) Aluminum Vaccine Adjuvants: Are they Safe? Current Medicinal Chemistry 18(17): 2630-2637.
[26] Shaw CA, Petrik MS (2009) Aluminum hydroxide injections lead to motor deficits and motor neuron degeneration. J Inorg Biochem 103(11): 1555-1562.
[27] Authier FJ, Sauvat S, Christov C, Chariot P, Raisbeck G, et al. (2006) AlOH3-adjuvanted vaccine-induced macrophagic myofasciitis in rats is influenced by the genetic background. Neuromuscul Disord 16(5): 347-352.
[28] Exley C, Esiri MM (2006) Severe cerebral congophilic angiopathy coincident with increased brain aluminium in a resident of Camelford, Cornwall, UK. J Neurol Neurosurg Psychiatry 77(7): 877- 879.
[29] Wills MR, Savory J (1985) Water content of aluminium, dialysis dementia, and osteomalacia. Environ Health Perspect 63: 141-147.
[30] Brinth L, Pors K, Theibel AC, Mehlsen J (2015) Suspected side effects to the quadrivalent human papilloma vaccine. Danish Medical J 62(4): 1-12.
[31] Palmieri B, Poddighe D, Vadalà M, Laurino C, Carnovale C, et al. (2016) Severe somatoform and dysautonomic syndromes after HPV vaccination: case series and review of literature. Immunol Res.
[32] Visani G, Manti A, Valentini L, Canonico B, Loscocco F, et al. (2016) Environmental nanoparticles are significantly over-expressed in acute myeloid leukemia. Leuk Res 50: 50-56.
[33] Artoni E, Sighinolfi GL, Gatti AM, Sebastiani M, Colaci M, et al. (2016) Micro and nanoparticles as possible pathogenetic co-factors in mixed cryoglobulinemia. Occupational Medicine.
[34] T Hansen, L Klimek, F Bittinger, I Hansen, A Gatti, et al. (2008) Mast cell reiches Aluminium granuloma Pathologe 29(4): 311-313.
[35] Gatti AM, Manti A, Valentini L, Montanari S, Gobbi P, et al. (2016) Nano biointeraction of particulate matter in the blood circulation. Frontiers 30: 3.
[36] Tenzer S, Docter D, Rosfa S, Wlodarski A, Kuharev J, et al. (2011) Nanoparticle size is a critical physicochemical determinant of the human blood plasma corona: a comprehensive quantitative proteomic analysis. ACS Nano 5(9): 7155-167.
[37] Radauer Preiml , Andosch A, Hawranek T, Luetz-Meindl U, Wiederstein M, et al. (2015) Nanoparticle-allergen interactions mediate human allergic responses: protein corona characterization and cellular responses. Fibre toxicology 13: 3.
[38] Cedervall T, Lynch I, Lindman S, Berggård T, Thulin E, et al. (2016) Understanding the nanoparticle-protein corona using methods to quantify exchange rates and affinities of proteins for nanoparticles. PNAS 104 (7): 2050-2055.
[39] Lynch I, Cedervall T, Lundqvist M, Cabaleiro-Lago C, Linse S, et al. (2007) The nanoparticle-protein complex as a biological entity; a complex fluids and surface science challenge for the 21st century. Advances in Colloid and Interface Science 134-135: 167-174.
[40] Gatti AM, Quaglino D, Sighinolfi GL (2009) A Morphological Approach to Monitor the Nanoparticle-Cell Interaction. International Journal of Imaging and Robotics 2: 2-21.
[41] Urban RM, Jacobs JJ, Gilbert JL, Galante JO (1994) Migration of corrosion products from modular hip prostheses. Particle microanalysis and histopathological findings. The Journal of Bone and Joint Surgery 76(9): 1345-1359.
[42] Kirkpatrick CJ, Barth S, Gerdes T, Krump-Konvalinkova V, Peters (K 2002) Pathomechanisms of impaired wound healing by metallic corrosion products. Mund Kiefer Gesichtschir 6(3): 183-190.
[43] Lee SH, Brennan FR, Jacobs JJ, Urban RM, Ragasa DR, et al. (1997) Human monocyte/macrophage response to cobalt-chromium corrosion products and titanium particles in patients with total joint replacements. J Orthop Res 15(1): 40-49.
[44] Shaw CA, Seneff S, Kette SD, Tomljenovic L, Oller Jr JW, et al. (2014) Aluminum-Induced Entropy in Biological Systems: Implications for Neurological Disease. Journal of Toxicology 2014: 491316.
[45] Shaw CA, Kette SD, Davidson RM, Seneff S (2013) Aluminum™s Role in CNS-immune System Interactions leading to Neurological Disorders. Immunome Research 9: 069.
[46] Seneff S, Swanson N, Chen Li (2015) Aluminum and Glyphosate Can Synergistically Induce Pineal Gland Pathology: Connection to Gut Dysbiosis and Neurological Disease. Agricultural Sciences 6(1): 42- 70.
[47] Pegaz B, Debefve E, Ballini JP, Konan-Kouakou YN, van den Bergh HJ (2006) Effect of nanoparticle size on the extravasations and the photothrombic activity of meso(p-tetracarboxyphenyl)porphyrin. J Photochem Photobiol B 85(3): 216-222.
[48] Brinth LS, Pors K, Hoppe AG, Badreldin I, Mehlsen J (2015) Is Chronic Fatigue Syndrome/Myalgic Encephalomyelitis a Relevant Diagnosis in Patients with Suspected Side Effects to Human Papilloma Virus Vaccine? International Journal of Vaccines and Vaccination 1(1):1-5.
[49] Moos WH, Faller DV, Harpp DN, Kanara I, Pernokas J, et al. (2016) Microbiota and Neurological Disorders: A Gut Feeling. Biores Open Access 5(1): 137-145.
[50] Sekirov I, Russell SL, Caetano L, Antunes M, Brett (2010) Gut Microbiota in Health and Disease. Physiological Rev 90(3): 859-904.
[51] Umbrello G, Esposito S (2016) Microbiota and neurologic diseases: potential effects of probiotics. J Transl Med 14(1): 298.
[52] Kino****a T, Abe RT, Hineno A, Tsunekawa K, Nakane S, et al. (2014) Peripheral sympathetic nerve dysfunction in adolescent Japanese girls following immunization with the human papillomavirus vaccine. Intern Med 53(19): 2185-2200.
[53] Zhang L, Richards A, Khalil A, Wogram E, Ma H, Young RA, Jaenisch R. SARS-CoV-2 RNA reverse-transcribed and integrated into the human genome. bioRxiv [Preprint]. 2020 Dec 13:2020.12.12.422516. doi: 10.1101/2020.12.12.422516. PMID: 33330870; PMCID: PMC7743078.
[54] Young, RO, "Forget Everything Else! Look at THE VAER's NUMBERS on Injuries and Deaths!." https://www.drrobertyoung.com/post/forget-everything-else-you-ve-heard-just-look-at-the-numbers5 (https://www.drrobertyoung.com/post/forget-everything-else-you-ve-heard-just-look-at-the-numbers5)
[55] Young, RO, "CDC NOW Admits NO 'Gold Standard' for the Isolation for ANY Virus!" https://www.drrobertyoung.com/post/cdc-now-admits-no-gold-standard-for-the-isolation-for-any-virus (https://www.drrobertyoung.com/post/cdc-now-admits-no-gold-standard-for-the-isolation-for-any-virus)
[56] Young, RO, "The Genesis of Severe Acute Respiratory (Syndrome) or SARS & Corona Virus or COVID - 19." https://www.drrobertyoung.com/post/the-genesis-of-severe-acute-respiratory-syndrome-or-sars-corona-virus-or-covid-19 (https://www.drrobertyoung.com/post/the-genesis-of-severe-acute-respiratory-syndrome-or-sars-corona-virus-or-covid-19)
[57] Young, RO, "What Causes Oxygen Deprivation of the Blood(DIC) and Then Lungs(SARS - CoV 2 & 19)?" https://www.drrobertyoung.com/post/what-causes-oxygen-deprivation (https://www.drrobertyoung.com/post/what-causes-oxygen-deprivation)
[58] Young RO, Migalko G (2020) What Causes Oxygen Deprivation of the Blood(DIC) and Then Lungs(SARS - CoV 2 & 12)?. Integ Mol Bio Biotechnol 1: 001-007. http://sciaeon.org/articles/What-Causes-Oxygen-Deprivation-of-the-Blood-DIC-and-Then-Lungs-SARS-CoV2and12.pdf
[59] Young RO (2016) Who Had Their Finger on the Magic of Life - Antoine Bechamp or Louis Pasteur?. Int J Vaccines Vaccin 2(5): 00047. DOI: 10.15406/ijvv.2016.02.00047 (https://doi.org/10.15406/ijvv.2016.02.00047)
Here is the pdf file for the above article for which you can share with everyone you love and care about:
GrapheneOxideVaccinePaperUpdated.pdf (https://download-files.wixmp.com/ugd/fbbf2b_1da51150351f45818e3d800a527ddeea.pdf?token=eyJ0eXAiOiJKV1QiLCJhbGciOiJIUzI1NiJ9.eyJpc3MiOiJ1c m46YXBwOmU2NjYzMGU3MTRmMDQ5MGFhZWExZjE0OWIzYjY5ZTMyIiwic3ViIjoidXJuOmFwcDplNjY2MzBlNzE0ZjA0OTBhYWVhM WYxNDliM2I2OWUzMiIsImF1ZCI6WyJ1cm46c2VydmljZTpmaWxlLmRvd25sb2FkIl0sImlhdCI6MTYzMDMzMDU0NywiZXhwIjoxN jMwMzY2NTU3LCJqdGkiOiIwN2UwNGJhMDVjMDMiLCJvYmoiOltbeyJwYXRoIjoiL3VnZC9mYmJmMmJfMWRhNTExNTAzNTFmNDU4M ThlM2Q4MDBhNTI3ZGRlZWEucGRmIn1dXSwiYXR0YWNobWVudCI6eyJmaWxlbmFtZSI6IkdyYXBoZW5lT3hpZGVWYWNjaW5lUGFwZ XJVcGRhdGVkLnBkZiJ9fQ.kVkTkKIwC-_xDZLFveQrPjL4d4XexI5BK_vTXUza_U4)
Download PDF (https://download-files.wixmp.com/ugd/fbbf2b_1da51150351f45818e3d800a527ddeea.pdf?token=eyJ0eXAiOiJKV1QiLCJhbGciOiJIUzI1NiJ9.eyJpc3MiOiJ1c m46YXBwOmU2NjYzMGU3MTRmMDQ5MGFhZWExZjE0OWIzYjY5ZTMyIiwic3ViIjoidXJuOmFwcDplNjY2MzBlNzE0ZjA0OTBhYWVhM WYxNDliM2I2OWUzMiIsImF1ZCI6WyJ1cm46c2VydmljZTpmaWxlLmRvd25sb2FkIl0sImlhdCI6MTYzMDMzMDU0NywiZXhwIjoxN jMwMzY2NTU3LCJqdGkiOiIwN2UwNGJhMDVjMDMiLCJvYmoiOltbeyJwYXRoIjoiL3VnZC9mYmJmMmJfMWRhNTExNTAzNTFmNDU4M ThlM2Q4MDBhNTI3ZGRlZWEucGRmIn1dXSwiYXR0YWNobWVudCI6eyJmaWxlbmFtZSI6IkdyYXBoZW5lT3hpZGVWYWNjaW5lUGFwZ XJVcGRhdGVkLnBkZiJ9fQ.kVkTkKIwC-_xDZLFveQrPjL4d4XexI5BK_vTXUza_U4) • 3.67MB
avid
30th August 2021, 14:32
Thank you so much Gwin Ru, a fantastic rationale, and what a mess we are in at the moment due to ‘ostrich’ mentality, or deliberate denial when the evidence stares us in the face. ‘How could they be so evil?’ - well it is now dawning on folk that greed, power and profiteering is paramount to those in positions of power rather than the care of humanity. As months go by, since this duplicitous wheedling to ‘vaccine’, we are now seeing folk getting very ill, and potentially dying due to this evil project. A curse on the instigators isn’t enough.
mountain_jim
30th August 2021, 14:42
great science info and work to post all of that here, Gwin Ru - thanks!
Pam
30th August 2021, 15:13
Scanning & Transmission Electron Microscopy Reveals Graphene Oxide in CoV-19 Vaccines (https://www.drrobertyoung.com/post/transmission-electron-microscopy-reveals-graphene-oxide-in-cov-19-vaccines)
Updated: 5 hours ago
2021, August 20
Author: Robert O Young CPC, MSc, DSc, PhD, Naturopathic Practitioner
www.drrberyoung.com
Phase Contrast Microscopy, Transmission and Scanning Electron Microscopy and Energy-Dispersive X-ray Spectroscopy Reveal the Ingredients in the CoV-19 Vaccines!
https://static.wixstatic.com/media/fbbf2b_acf6a99ad5be43e5a78d81ba4a2d3df5~mv2.png/v1/fill/w_740,h_359,al_c,q_95/fbbf2b_acf6a99ad5be43e5a78d81ba4a2d3df5~mv2.webp (https://www.drrobertyoung.com/blog/search/germs)
Germs Are Born In Us and From Us as an Outfection and NOT an Infection of the Body Cells. In other words germs are symptoms of cellular and genetic disorganization and NOT the specific cause of the cellular and genetic disorganization! The GERM is NOTHING and the TERRAIN is EVERYTHING . Germs can only contribute to a state of toxic imbalance but NEVER cause ANY specific sickness or disease![55] - Dr. Robert O. Young (https://www.drrobertyoung.com/blog/search/germs)
Abstract
Currently there are four major pharmaceutical companies who manufacture a SARS-CoV-2 now called SARS-CoV-19 vaccine. These manufactures and their vaccine are Pfizer--BioNTech mRNA Vaccine, the Moderna-Lonza mRNA-1273 Vaccine, the Serum Institute Oxford Astrazeneca Vaccine and the Janssen COVID -19 Vaccine, manufactured by Janssen Biotech Inc., a Janssen Pharmaceutical Company of Johnson & Johnson, a recombinant, replication-incompetent adenovirus type 26 expressing the SARS-CoV-2 spike protein. The intended purpose of these vaccines are to provide immunity from the so-called infectious novel coronavirus or SARS-CoV - 2 virus now called the SARS-CoV - 19. These four pharmaceutical companies have not provided complete FDA disclosure on their vaccine box, insert fact sheet or label for many of the major and/or minor ingredients contained within these so-called vaccines. The purpose of this research article is to identify those specific major and minor ingredients contained in the Pfizer Vaccine, the Moderna Vaccine, the Astrazeneca Vaccine and the Janssen Vaccine using various scientific anatomical, physiological and functional testing for each SARS-COV-2-19 vaccine. As a human right, governed under World Law by the Nuremberg Code of 1947, the vaccine specific ingredient information is critical, required and necessary to know so that any human from any country in the World can make an informed decision whether or not to consent to the SAR-CoV-2-19 inoculation. We have conducted the scientific testing on each vaccine and have identified several ingredients or adjuvants that have not been disclosed which are contained in these four SARS-CoV - 2 -19 vaccines. Currently, these vaccines are being administered to millions of humans around the World under an Emergency Use Authorization (EUA) issued by each country without full disclosure of all ingredients and in some cases mandated by governments or employers in violation of individual human rights under the Nuremberg Code of 1947.
Methodology and Techniques
Four “vaccines” were analyzed which are the Pfizer-BioNtech, Moderna-Lonza mRNA-1273 Vaccine, Vaxzevria by Astrazeneca, Janssen by Johnson & Johnson, using different instrumentation and protocols of preparation according to new nano particulate technological approaches. The different instrumentation includes Optical Microscopy, Bright-Field Microscopy, pHase Contrast Microscopy, Dark-Field Microscopy, UV absorbance and Fluorescence Spectroscopy, Scanning Electron Microscopy, Transmission Electron Microscopy, Energy Dispersive Spectroscopy, X-ray Diffractometer, Nuclear Magnetic Resonance instruments were used to verify the “vaccines” morphologies and contents. For the high-technology measurements and the care of the investigation, all the controls were activated and reference measurements adopted in order to obtain validated results.
Live Blood Phase Contrast and Dark-Field Microscopy
Images of the aqueous fractions of the vaccines were subsequently obtained to visually assess the possible presence of carbon particulates or graphene.
The observations under optical microscopy revealed and abundance of transparent 2D laminar objects that show great similarity with images from literature (Xu et al, 2019), and with images obtained from rGO standard (SIGMA)(Figures 1, 2 and 3).
Images of big transparent sheets of variable size and shapes were obtained, showing corrugated and flat, irregular. Smaller sheets of polygonal shapes, also similar to flakes described in literature (Xu et al, 2019) can be revealed with pHase Contrast and Dark-Field microscopy (Figure 3).
All these laminar objects were widespread in the aqueous fraction of the blood (Figure 1) or vaccine sample (Figures 2 and 3) and no component described by the registered patent can be associated with these sheets.
In Figure 1 You Can See What A Cluster Bomb of Reduced Graphene Oxide (rGO) Looks Like in the Live Unstained Human Blood after a CoV-19 Inoculation Causing Pathological Blood Coagulation![1][2][55][56][57]
https://static.wixstatic.com/media/fbbf2b_7ddf1a00d004487782b64a1f15a3aa27~mv2.png/v1/fill/w_740,h_548,al_c,q_95/fbbf2b_7ddf1a00d004487782b64a1f15a3aa27~mv2.webp (https://www.drrobertyoung.com/post/what-causes-oxygen-deprivation)
Figure 1 is a Micrograph of a Carbon Cluster of Reduced Graphene Oxide (rGO) Viewed in the Live Unstained Human Blood with pHase Contrast Microscopy at 1500x. Note that the Red Blood Cells are Clotting in and Around the rGO Crystal in a Condition Known as Rouleau! A French Word Which Means to Chain. (https://www.drrobertyoung.com/post/what-causes-oxygen-deprivation)
What Are the Non-Disclosed Ingredients Contained in CoV - 19 So-Called Pfizer, Moderna, Astrazeneca and Janssen Vaccines?
To answer this question an aqueous fraction of the Pfizer, Moderna, Astrazeneca and Janssen vaccines were taken from each vile and then viewed separately under pHase Contrast Microscopy at 100x, 600x up to1500x magnification showing anatomical evidence of reduced Graphene Oxide (rGO) particulates which were compared to micrographs of rGO from Choucair et al, 2009 for identification and verification.[3]
Steps of Analysis of Vaccine Aqueous Fractions
Refrigerated samples were processed under sterile conditions, using laminar flow chamber and sterilized lab ware.
Steps for analyses were:
1. Dilution in 0.9% sterile physiological saline (0.45 ml + 1.2 ml)
2. Polarity fractionation: 1.2 ml hexane + 120 ul of RD1 sample
3. Extraction of hydrophilic aqueous pHase
4. UV absorbance and fluorescence spectroscopy scanning
https://static.wixstatic.com/media/fbbf2b_f634f46ae6e84db5861152d7a2a07965~mv2.png/v1/fill/w_740,h_433,al_c,q_95/fbbf2b_f634f46ae6e84db5861152d7a2a07965~mv2.webp
5. Extraction and quantification of RNA in the sample
6. Electron and optical microscopy of aqueous pHase
The Pfizer "Vaccine" Non-disclosed Ingredients
The micrographs in Figures 2 and 3 were obtained using 100X, 600X and 1500X pHase Contrast, Dark Field and Bright Field Optical Microscopy.[3]
On the left of each micrograph you will view micrographs obtained from the Pfizer vaccine aqueous fraction containing rGO.
On the right of each micrograph ou will view a match from known sources containing rGO for anatomical validation.
The observations under a pHase Contrast, Dark-Field, Bright-Field microscopy, Transmission and Scanning Electron microscopy of the vaccine product by Pfizer, including vaccine products of Moderna, Astrazeneca and Janssen revealed some entities that can be graphene strips as seen below in Figure 3.
https://static.wixstatic.com/media/fbbf2b_acdddb2995cd472ba6ddc5283bf48949~mv2.png/v1/fill/w_740,h_275,al_c,q_95/fbbf2b_acdddb2995cd472ba6ddc5283bf48949~mv2.webp
Figure 2 shows an aqueous fraction image from Pfizer vaccine sample (left) and from reduced graphene oxide (rGO) standard (right) (Sigma-777684). Optical microscopy, 100X
https://static.wixstatic.com/media/fbbf2b_aacb78604f3b49bb8ea147ba94b23195~mv2.png/v1/fill/w_740,h_565,al_c,q_95/fbbf2b_aacb78604f3b49bb8ea147ba94b23195~mv2.webp
Figure 3 - Aqueous fraction images containing reduced graphene oxide from Pfizer vaccine sample (left) and sonicated reduced graphene oxide (rGO) standard (right) (Sigma-777684). Optical pHase contrast microscopy, 600X. In addition, the Muestra RD1, La Quinta Columna Report, June 28, 2021; Graphene Oxide Detection in Aqueous Suspension; Delgado Martin, Campra Madrid confirms our findings. [4]
https://static.wixstatic.com/media/fbbf2b_9c37c1bfdad34160bf04352134342e26~mv2.png/v1/fill/w_740,h_504,al_c,q_95/fbbf2b_9c37c1bfdad34160bf04352134342e26~mv2.webp
Figure 4 shows the liposome Capsid containing rGO that Pfizer uses for its product to vehiculate the graphene oxide by attaching the Liposome capsid to specific mRNA molecules for driving the Liposome contents of fGO to specific organs, glands and tissues, namely the ovaries and testes, bone marrow, heart and brain. The image was obtained by a SEM-Cryo preparation.
For a definitive identification of graphene by TEM, it is necessary to complement the observation with the structural characterization by obtaining a characteristic electron diffraction standard sample (as the figure 'b' shown below).[4]
The standard sample corresponding to graphite or graphene has a hexagonal symmetry, and generally has several concentric hexagons.
https://static.wixstatic.com/media/fbbf2b_573b8c4faf674889a067b1828405b103~mv2.png/v1/fill/w_740,h_305,al_c,q_95/fbbf2b_573b8c4faf674889a067b1828405b103~mv2.webp
Figure 4b Reveals X ray Diffraction Pattern of the Graphene Particles. [4]
Using Transmission Electron Microscopy (TEM) we observed an intricate matrix or mesh of folded translucent flexible rGO sheets with a mixture of darker multilayer agglomerations and lighter colored of unfolded monolayers as seen in Figure 5. [3][4]
https://static.wixstatic.com/media/fbbf2b_1d24923a402d491cab65d7654d442e88~mv2.png/v1/fill/w_740,h_547,al_c,q_95/fbbf2b_1d24923a402d491cab65d7654d442e88~mv2.webp
Figure 5 shows a cluster of graphene nanoparticles in a Pfizer vaccine. They appear to be aggregated.
The darker linear areas in Figure 5 appear to be local overlap of sheets and local arrangement of individual sheets in parallel to the electron beam.[5]
After the mesh, a high density of unidentified rounded and elliptical clear shapes appears, possibly corresponding to holes generated by mechanical forcing of the rGO mesh during treatment as seen in Figure 6.[4][5]
https://static.wixstatic.com/media/fbbf2b_e8418f44ce284c55b40469d2b9fe3ff1~mv2.png/v1/fill/w_740,h_246,al_c,q_95/fbbf2b_e8418f44ce284c55b40469d2b9fe3ff1~mv2.webp
Figure 6 shows a TEM microscopy observation where particles of reduced graphene oxide in a Pfizer” vaccine” are present. The X-ray diffractometry reveals their nature of crystalline Carbon-based nanoparticles of rGO. This evidence was intitially found by Muestra RD1, and published in the La Quinta Columna Report, June 28, 2021; Graphene Oxide Detection in Aqueous Suspension; Delgado Martin, Campra Madrid. [4]
The Immune Response to Dietary, Metabolic, Environmental and Inoculated Organic and Inorganic Micro and Nano Particulates
The bright orange blood crystal below is solidified uric acid from the ingestion of a high protein diet from animal flesh, blood and interstitial fluids. You will note that there are several neutrophils attempting to clean-up and remove this toxic mass. This is the main purpse of white blood cells to manage and maintain the delicale pH of balance of the bod fluids.
yKONi_hDsfE
As you watch the video above you view two neutrophils (neutrophils make up 2/3rds of the total white blood count) swimming through the blood plasma. The neutrophil from the left is moving downward to pick up a biological transformation of a Y-form yeast, like Candida albicans.
This is the main function of neutrophils to pick up organic and non-organic micro and nano particulates, such as graphene oxide as seen in the micrograph below labeled GO and the neutrophil labeled NET. The neutrophil is attempting to pick up and remove the graphene oxide, a toxic acidic poison which is contained in all CoV - 2 - 19 so-called vaccines!
https://static.wixstatic.com/media/fbbf2b_373e02806ffa44dd9197f8ce1d7e5c2d~mv2.png/v1/fill/w_740,h_744,al_c,q_95/fbbf2b_373e02806ffa44dd9197f8ce1d7e5c2d~mv2.webp
The micrograph above is showing the graphene oxide (GO) and the poisoning and destruction of the neutrophils (NET - which make up over 60 percent of all white blood cells) which are designed to pick up and eliminate foreign toxic chemical waste and biologicals.
Energy-Dispersive X-ray Spectroscopy Reveals rGO in Pfizer Vaccine[5][6][7]
The Pfizer vaccine liquid fraction was then analyzed for chemical and elemental content using Energy-dispersive X-ray spectroscopy (EDS) as seen in Figure 6. The EDS spectrum showed the presence of Carbon, Oxygen verifying the rGO elements and Sodium and Chloride since the sample shown in Figures 2, 3, 5,and 6 were diluted in a saline solution.
https://static.wixstatic.com/media/fbbf2b_95e1e01cef48405898a2451af9b28ce7~mv2.png/v1/fill/w_740,h_278,al_c,q_95/fbbf2b_95e1e01cef48405898a2451af9b28ce7~mv2.webp
Figure 7 shows an EDS spectrum of a Pfizer “vaccine” under an ESEM microscopy coupled with an EDS x-ray microprobe (X axis =KeV, Y axis = Counts) identifying Carbon, Oxygen, Sodium and Chloride
The Quantification of mRNA in the Pfizer Vaccine
The quantification of RNA in the Pfizer sample was carried out with conventional protocols (Fisher).
According to NanoDropTM 2000 spectrophotometer calibration check specific software (Thermofisher), the UV absorption spectrum of total aqueous fraction was correlated to 747 ng/ul of unknown absorbing substances.
However, after RNA extraction with commercial kit (Thermofisher), quantification with RNA specific Qbit fluorescence probe (Thermofisher) showed that only 6t ug/ul could be related to the presence of RNA. The spectrum was compatible with the peak of rGO at 270nm.
According to microscopic images presented here, most of this absorbance might be due to graphene-like sheets, abundant in the fluids suspension in the sample.
The conclusions are further supported by high fluorescence from the sample with maximum at 340 nm, in accordance with peak values for rGO. It must be reminded that RNA does not show spontaneous fluorescence under UV exposure.
https://static.wixstatic.com/media/fbbf2b_61ff08edb96942ddb1e76d7b21be8c97~mv2.png/v1/fill/w_740,h_429,al_c,q_95/fbbf2b_61ff08edb96942ddb1e76d7b21be8c97~mv2.webp
Figure 8 - UV spectrum of aqueous fraction of Pfizer vaccine sample.[1][2][3][5][6]
Ultra Violet Fluorescence Testing of the Pfizer Aqueous Fraction for Reduced Graphene Oxide (rGO)[6]
Ultra Violet absorption and fluorescence spectra were obtained with Cytation 5 Cell Imaging Multi-Mode Reader Spectrophotometer (BioteK). UV absorbance spectrum confirmed a maximum peak at 270nm, compatible with presence of rGO particulate.
UV fluorescence maximum at 340 nm also suggests presence of significant amounts of rGO in the sample (Bano et al, 2019).
https://static.wixstatic.com/media/fbbf2b_c708016d104c4a41a4a2516c6599d1a8~mv2.png/v1/fill/w_740,h_353,al_c,q_95/fbbf2b_c708016d104c4a41a4a2516c6599d1a8~mv2.webp
Figure 9 - UV absorption and fluorescence spectra were obtained with Cytation 5 Cell Imaging Multi-Mode Reader Spectrophotometer (BioteK). UV absorbance spectrum confirmed a maximum peak at 270 nm, compatible with presence of rGO. UV fluorescence maximum at 340 nm also suggests presence of significant amounts of rGO in the sample (Bano et al, 2019).
https://static.wixstatic.com/media/fbbf2b_35a5b27b3e48495399c55809d316dd54~mv2.png/v1/fill/w_740,h_373,al_c,q_95/fbbf2b_35a5b27b3e48495399c55809d316dd54~mv2.webp
Figure 10 - The spectroscopy UV analysis showed an adsorption due to the presence of reduced graphene oxide, which is confirmed by observation under ultraviolet visible microscopy.
Figures 11 and 12 below shows a micrograph of different micro and nano particulates which have been identified in the Pfizer, Moderna, Astrazeneca and Janssen, so-called “vaccines” and analyzed under an Environmental Scanning Electron Microscope (SEM) coupled with an x-ray microprobe of an Energy Dispersive System (EDS) that reveals the particle size, composition distribution (https://rtilab.com/analytical-services/particle-analysis/)and chemical nature of the observed micro and nano particulates under observation.[6][7][8]
https://static.wixstatic.com/media/fbbf2b_d89760ebddf74c4dbdcfda2d7648a1a1~mv2.png/v1/fill/w_740,h_511,al_c,q_95/fbbf2b_d89760ebddf74c4dbdcfda2d7648a1a1~mv2.webp
Figure 11 shows sharp micron debris of 20 um in length identified in the Pfizer so-called “vaccine” containing Carbon, Oxygen Chromium, Sulphur, Aluminum, Chloride, Nitrogen.
https://static.wixstatic.com/media/fbbf2b_c5534127ea5b49df8333ba2375ee2abc~mv2.png/v1/fill/w_740,h_253,al_c,q_95/fbbf2b_c5534127ea5b49df8333ba2375ee2abc~mv2.webp
Figure 12 shows a 20 micron in length particulate identified in the so-called Pfizer “vaccine”. It is composed of carbon, oxygen chromium, sulphur, aluminum, chloride and nitrogen.
Figures 13 and 14 below shows a micrograph of different micro and nano particulates which have been identified in the Pfizer, Moderna, Astrazeneca and Janssen, so-called “vaccines” and analyzed under an Environmental Scanning Electron Microscope (SEM) coupled with an x-ray microprobe of an Energy Dispersive System (EDS) that reveals the particle size, composition distribution (https://rtilab.com/analytical-services/particle-analysis/)and chemical nature of the observed micro and nano particulates under observation.
Are There Parasites in the Pfizer "Vaccines"?
A 50 micron elongated body, as seen in Figure 13 is a sharp mysterious presence in the Pfizer vaccine. It appears and is identified anatomically as a Trypanosoma cruzi parasite of which several variants are lethal and is one of many causes of acquired immune deficiency syndrome or AIDS.[Atlas of Human Parasitology, 4th Edition, Lawrence Ash and Thomas Orithel, pages 174 to 178][9]
https://static.wixstatic.com/media/fbbf2b_1d1c4b6f9aae43158158363afaf576c2~mv2.png/v1/fill/w_740,h_514,al_c,q_95/fbbf2b_1d1c4b6f9aae43158158363afaf576c2~mv2.webp
Figure 13 shows a Trypanosoma Parasite approximately 20 microns in length found in the so-called Pfizer “vaccine”. It is composed of carbon, oxygen chromium, sulphur, aluminum, chloride and nitrogen.
https://static.wixstatic.com/media/fbbf2b_afefe13d4e5f4c77bfe0d056275a5cc6~mv2.png/v1/fill/w_740,h_424,al_c,q_95/fbbf2b_afefe13d4e5f4c77bfe0d056275a5cc6~mv2.webp
A Live Blood pHase Contrast Microscopy Micrograph of Trypanosoma cruzi Parasite[9]
... continued below...
Could the parasites be one of the reasons that Ivermectin is an effective treatment? It is after all an antiparasitic. The packaging ironically states that it kill bots as well, whatever they mean by that.
Once again, thank you Gwin Ru for the brilliant presentation of information.
ThePythonicCow
30th August 2021, 21:09
Scanning & Transmission Electron Microscopy Reveals Graphene Oxide in CoV-19 Vaccines (https://www.drrobertyoung.com/post/transmission-electron-microscopy-reveals-graphene-oxide-in-cov-19-vaccines)
That's a most excellent article by Dr. Robert O. Young - thanks for posting it, Gwin Ru.
For my own amusement, and perhaps of use to others, here's a list of the various "Non-Disclosed Ingredients Contained in CoV - 19 So-Called Pfizer, Moderna, Astrazeneca and Janssen Vaccines" that Dr. Young found in these vaxxx's:
reduced Graphene Oxide (rGO) particulates,
various micro and nano particulates,
Trypanosoma cruzi parasite,
particulates composed of carbon, oxygen chromium, sulphur, aluminum, chloride and nitrogen,
particulates composed of bismuth, carbon, oxygen, aluminum, sodium, copper and nitrogen,
particulates composed of bismuth, titanium, vanadium, iron, copper, silicon and aluminum,
aggregates of iron, chromium and nickel (aka stainless steel),
molecules of histidine,
molecules of sucrose,
molecules of Poly-ethylene glycol (PEG),
molecules of ethylene alcohol,
particles of stainless steel glued with reduced graphene oxide (highly magnetic),
particles composed of carbon, nitrogen, oxygen, aluminum, copper, iron and chlorine,
rGO contaminated with nano particulates of nitrogen, silicon, phosphorus and chlorine,
quantum dots of cadmium selenide, and
rGO mixed with aggregates filled with Aluminium silicate nanoparticulates,
In short, to repeat Dr Young's summary:
The Pfizer, Moderna, Astrazeneca and Janssen drugs are NOT "vaccines" but complexed Graphene Oxide nano particulate aggregates of varying nano elements attached to genetically modified nucleic acids of mRNA from animal or vero cells and aborted human fetal cells as viewed and described above. Once again the ingredients in these so-called vaccines are highly magneticotoxic, cytotoxic and genotoxic to plant, insect, bird, animal and human cell membranes and their genetics which already has lead to serious injuries (estimated at over 500 million) and/or eventual death (estimated at over 35 million).
Delight
31st August 2021, 05:08
Sorry if already posted.....
Saw article but missed video....
major reveals on what is in the vaccines, with use of electron and other kinds of microscopy from original research by Dr. Robert Young and his team, confirming what the La Quinta Columna researchers found---toxic nanometallic content with cytotoxic and genotoxic effects as well as an identified parasite. This is major revelation: please stay tuned for a major article reporting this at ECC, meanwhile please share this video widely!
LINKS FOR MORE:
Dr. Young's major article reporting his findings:
https://www.drrobertyoung.com/post/transmission-electron-microscopy-reveals-graphene-oxide-in-cov-19-vaccines
PREVIOUS PODCAST WITH DR. YOUNG WHERE HE EXPLAINS MORE ON THESE SUBJECTS:
Report 255 | Dr. Robert Young: All Disease is Outfection Not Infection--Vaccine Nano is Bioweapon!
https://www.bitchute.com/video/rdQhuY455VmK/
WATCH NEWSBREAK ON BRIGHTEON, RUMBLE, ODYSEE IF ANY ISSUES HERE:
https://www.brighteon.com/41a5a50b-5369-4ccc-8f65-1d2ddbcbf3c4
https://rumble.com/vlonug-electron-microscopy-reveals-graphene-oxide-in-cov-19-vaccines.html
https://odysee.com/@RamolaDReports:8/Newsbreak-133--Dr.-Robert-Young:b
ARTICLE ON NEWSBREAK 133:
Newsbreak 133: Team of Scientists Confirm Presence of Toxins Graphene, Aluminium, Cadmium Selenide, Stainless Steel, LNP-GO Capsids, Parasites, Other Toxins Variously in 4 COVID Vaccines: Pfizer, Moderna, AstraZeneca, Johnson & Johnson
https://everydayconcerned.net/2021/08/28/newsbreak-133-team-of-scientists-confirm-presence-of-toxins-graphene-aluminium-cadmium-selenide-stainless-steel-lnp-go-capsids-parasites-other-toxins-variously-in-4-covid-vaccines-pfizer-mode/
Research for the Carnicom Disclosure Project on Magnetism, Trans-humanism, Synthetic Biology, Vaccine Poisons, Bio Surveillance, Neuromodulation, Electromagnetic Bio-Human Effects, Virus Confusions, Terrain and Blood Health and the Secret Elixir of Life -
https://www.bitchute.com/video/reT2JVKTlWmB/
Scientific Articles - www.drrobertyoung.com/blog
CV - www.drrobertyoung.com
Bitchute Videos - https://www.bitchute.com/search/?query=dr%20robert%20o%20young&kind=video - 121
NEW Interviews and Lectures
You Tube Videos - https://www.youtube.com/c/RobertYoung555/playlists - 1000's of videos to watch
Rumble Videos - https://rumble.com/search/video?q=drrobertyoung - 50 recent interviews recorded on Zoom
Odessy Videos - https://odysee.com/@DrRobertYoung:7
Freedom of Information responses from 90 institutions (including Public Health Agency of Canada, US CDC, UK Depart of Health and Social Care, Indian Council of Medical Research) in 20 countries/jurisdictions show that health/science institutions have NO RECORD of "SARS-COV-2" isolation/purification from ANY patient sample, by ANYONE, ANYWHERE, EVER! - HERE IS THE LINK:
https://www.fluoridefreepeel.ca/fois-reveal-that-health-science-institutions-around-the-world-have-no-record-of-sars-cov-2-isolation-purification/
***
SUBSCRIBE, LIKE, SHARE, SUPPORT THIS CHANNEL
PRINT SITE: WWW.EVERYDAYCONCERNED.NET
VIDEO CHANNELS/RAMOLA D REPORTS AT BITCHUTE, BRIGHTEON, ODYSEE, LIVE528
Z2sAH0Woz38r
pueblo
31st August 2021, 11:07
Microscopy Expert: Vials Contain Graphene Oxide, Parasites, Stainless Steel
Rumble — Dr. Robert Young, a microscopy expert holding two PhD's says he has examined the contents of the four publicly-available CoV-19 "vaccines", and determined the vials to contain graphene oxide, deadly parasites and stainless steel, among other metals and contents.
Dr. Jane Ruby joins Stew Peters to break the findings, and issues a WARNING to anyone considering the inoculation.
vj8hnc/?pub=4
ExomatrixTV
31st August 2021, 11:38
Two men in their 30s died last week after receiving covid shots from Moderna that officials discovered contained “foreign matter” that “reacts to magnets.” (http://www.informationliberation.com/?id=62490)
Japan Halts 1.6m Moderna Doses After Additional Vials Found to Contain ‘Foreign Substances (https://www.infowars.com/posts/japan-halts-2-6m-moderna-doses-after-additional-vials-found-to-contain-foreign-substances-2-men-die/)’, 2 Men Died
Two men with no pre-existing illnesses died days after receiving Moderna vaccines from a batch in Japan contaminated with tiny metal flakes.
Thirty-nine vaccine vials were found to contain the fragments last week at eight centres in five prefectures, including Tokyo. They were part of three batches made for Moderna in Spain. At least 180,000 people are understood to have been injected from the batches.
source (https://www.thetimes.co.uk/article/fears-over-metal-flakes-in-moderna-vaccine-after-two-deaths-vvmvvdqpw)
bluestflame
1st September 2021, 00:21
OrtuVAn6gCZB/
Dr. Chinda Brandolino on the nanoprocessor in the 'vaccine
onawah
3rd September 2021, 18:21
Review for :MICROSCOPY EXPERT: VIALS CONTAIN GRAPHENE OXIDE, PARASITES, STAINLESS STEEL
https://forbiddenknowledgetv.net/microscopy-expert-vials-contain-graphene-oxide-parasites-stainless-steel/
9/1/21
"Dr Jane Ruby joins Stew Peters to discuss the findings of Dr Robert O Young, published on August 20th, entitled, “Scanning & Transmission Electron Microscopy Reveals Graphene Oxide in CoV-19 Vaccines”.
This report should be considered a warning to anyone considering the jab.
Dr Young is a microscopy expert who published his findings, complete with images, after examining the contents of the four publicly-available COVID-19 jabs with various microscopy methods, including Phase Contrast Microscopy, Transmission and Scanning Electron Microscopy and Energy-Dispersive X-Ray Spectroscopy.
He determined that the vials contain graphene oxide and nano-sized particles of stainless steel and other toxic metals, which we had already been hearing about, starting with Dr Ruby’s appearances with Stew Peters in early June.
She cited papers published by the NIH about “Manipulative magnetic nanomedicine” as “the future of COVID-19 pandemic therapy” and about SPIONs or Superparamagnetic Iron Oxide Nanoparticles, in which a magnetic field is placed in and around the lipid-nanoparticle envelope surrounding the mRNA, to drive the spike protein manufacturing technology deep into your cells.
We get a bit more information here about how that mechanism might work from Dr Young’s report. He says the Johnson & Johnson vaccine contains particles composed of stainless steel that are stuck together with a “carbon-based glue” of reduced graphene oxide (rGO) that induce pathological blood coagulation through the continuous degeneration of cell membranes.
Dr Young’s most shocking finding, by far is that the vaccines contain the lethal tropical parasite, Trypanosoma cruzi, a microorganism endemic to Latin America that causes Chagas disease.
September 7th can’t come soon enough, when Pfizer is obliged to deliver the complete ingredient list of the vaxx to the FDA, because right now, it looks like the “vaccine” is a deadly cocktail of graphene oxide, SPIONS, spike protein-producing synthetic mRNA and a tropical parasite that causes chronic disease and death!
Dr Ruby says numerous labs are now attempting to confirm or discredit these results.
THE SYMPTOMOLOGY OF CHAGAS DISEASE
The implications of Dr Young’s discovery of Trypanosoma Cruzi parasites in the vials are that we may now view the myriad crippling “vaccine side effects” and even the “multi-organ” effects of “Long-Haul COVID” in a new light, when we understand that some of these symptoms might be related to the early stages of chronic Chagas disease.
The T. cruzi single-celled parasite burrows into human tissue to feed on blood. After 4-8 weeks, the infection becomes Chagas disease, an incurable chronic condition with very few symptoms for years until the the organs become so scarred and damaged by the tiny parasites, that it causes heart disease and digestive complications. Chagas disease has no cure and the symptoms can only be managed.
In nature, T. cruzi is usually introduced into the host via the bite of various species of “kissing bugs”. Although the insect vector was eliminated in many countries, it continued to be spread via blood transfusions and organ transplants until 15-20 years ago.
Chagas disease occurs in two stages: 1) Acute stage, which develops one to two weeks after the insect bite, and; 2) Chronic stage, which develops over many years.
In 1–5% of infected individuals, the acute phase can cause life-threatening fluid accumulation around the heart, or inflammation of the heart or brain and surrounding tissues. (Where have we heard that before?)
Unless treated with anti-parasitic drugs, individuals remain chronically-infected with T. cruzi after recovering from the acute phase.
Over decades, 30–40% of people develop organ dysfunction, the most common of which is heart disease. People with Chagas heart disease often experience heart palpitations and sometimes fainting, due to irregular heart function.
IS T. CRUZI A REASON WHY ANTI-PARASITIC DRUGS ARE EFFECTIVE AGAINST COVID-19 & AGAINST THE VAXX “SIDE EFFECTS”?
I do not mean to add to the confusion about the fake pandemic, with its origins in a bioweapons program – or to its attendant forced “vaccine”, with its its Nuremberg Code-violating lack of informed consent.
However, we have long suspected that the PCR test statistics-driven plandemic was a ruse to “vaccinate the entire planetary population”, to quote Bill Gates and we have since learned that the so-called “vaccine” actually contains a more concentrated form of the weaponized spike protein than the “virus” it’s supposed to treat.
Would those seeking to create bioweapons stop at a respiratory tract-infecting coronavirus? T. cruzi can survive freezing and thawing, allowing it to persist in whole blood and blood products.
An organism like T. cruzi might be a handy in a bioweapons arsenal.
Is the composition of the Franken Clot Shot even more diabolical than we thought?
As Stew says, “This sounds like an intentionally-manufactured cocktail of lethal ingredients being injected forcefully into people in certain places, coerced in other places. People are losing their jobs if they don’t get this thing and they want to lower the age group to 5 years old, to inject as many kids with this thing as possible.
“And Australia, led 24,000 people – kids – unaccompanied by parents or adults into a former sports arena, now turned into the modern-day ‘ovens’ to inject these kids, multiples of which, we have unconfirmed reports are dead. Parents are coming forward, people are upset about this, understandably.
He asks Dr Ruby, “Would you suspect that there would be any medical – any justifiable medical benefit to a cocktail made of these ingredients?”
She shakes her head in the negative, “There’s no disclosure. There’s no informed consent consideration provided to the people that are being forced to take this – ”
Stew interrupts, “Consideration means, nothing anymore. They’re not even a part of considering, in many cases whether or not they are given the choice to take this.
“They are just being told, ‘Take it or be out of a job. Take it or be court-martialed,’ in the military. ‘Go to jail. Go to the brig if you don’t take this thing.'” "
Contributed by Alexandra Bruce
Merkaba360
7th September 2021, 12:35
I agree with Bill that the 99% GO sounds ridiculous. From what I can tell, Graphene Oxide is a solid. So, clearly they arent saying the injection is 99% GO or they'd be injecting a rock. lol I assume they mean that 99% of the nanoparticles floating around are GO ? Im sure there is many chemicals in there, highly doubt 99% is possible or desirable.
Agreed the Spain info must be disinfo or something trying to make us look like nut jobs and distract us by exaggerating. Taking 10 different vaccines and testing them for ingredients is not hard for a scientific lab. Cant we get a university and some established labs to be useful. lol We really need a billionaire to open a fact checking lab, cuz science is such a pain in the butt for people to understand or believe.
Pam
7th September 2021, 13:05
Review for :MICROSCOPY EXPERT: VIALS CONTAIN GRAPHENE OXIDE, PARASITES, STAINLESS STEEL
https://forbiddenknowledgetv.net/microscopy-expert-vials-contain-graphene-oxide-parasites-stainless-steel/
9/1/21
"Dr Jane Ruby joins Stew Peters to discuss the findings of Dr Robert O Young, published on August 20th, entitled, “Scanning & Transmission Electron Microscopy Reveals Graphene Oxide in CoV-19 Vaccines”.
This report should be considered a warning to anyone considering the jab.
Dr Young is a microscopy expert who published his findings, complete with images, after examining the contents of the four publicly-available COVID-19 jabs with various microscopy methods, including Phase Contrast Microscopy, Transmission and Scanning Electron Microscopy and Energy-Dispersive X-Ray Spectroscopy.
He determined that the vials contain graphene oxide and nano-sized particles of stainless steel and other toxic metals, which we had already been hearing about, starting with Dr Ruby’s appearances with Stew Peters in early June.
She cited papers published by the NIH about “Manipulative magnetic nanomedicine” as “the future of COVID-19 pandemic therapy” and about SPIONs or Superparamagnetic Iron Oxide Nanoparticles, in which a magnetic field is placed in and around the lipid-nanoparticle envelope surrounding the mRNA, to drive the spike protein manufacturing technology deep into your cells.
We get a bit more information here about how that mechanism might work from Dr Young’s report. He says the Johnson & Johnson vaccine contains particles composed of stainless steel that are stuck together with a “carbon-based glue” of reduced graphene oxide (rGO) that induce pathological blood coagulation through the continuous degeneration of cell membranes.
Dr Young’s most shocking finding, by far is that the vaccines contain the lethal tropical parasite, Trypanosoma cruzi, a microorganism endemic to Latin America that causes Chagas disease.
September 7th can’t come soon enough, when Pfizer is obliged to deliver the complete ingredient list of the vaxx to the FDA, because right now, it looks like the “vaccine” is a deadly cocktail of graphene oxide, SPIONS, spike protein-producing synthetic mRNA and a tropical parasite that causes chronic disease and death!
Dr Ruby says numerous labs are now attempting to confirm or discredit these results.
THE SYMPTOMOLOGY OF CHAGAS DISEASE
The implications of Dr Young’s discovery of Trypanosoma Cruzi parasites in the vials are that we may now view the myriad crippling “vaccine side effects” and even the “multi-organ” effects of “Long-Haul COVID” in a new light, when we understand that some of these symptoms might be related to the early stages of chronic Chagas disease.
The T. cruzi single-celled parasite burrows into human tissue to feed on blood. After 4-8 weeks, the infection becomes Chagas disease, an incurable chronic condition with very few symptoms for years until the the organs become so scarred and damaged by the tiny parasites, that it causes heart disease and digestive complications. Chagas disease has no cure and the symptoms can only be managed.
In nature, T. cruzi is usually introduced into the host via the bite of various species of “kissing bugs”. Although the insect vector was eliminated in many countries, it continued to be spread via blood transfusions and organ transplants until 15-20 years ago.
Chagas disease occurs in two stages: 1) Acute stage, which develops one to two weeks after the insect bite, and; 2) Chronic stage, which develops over many years.
In 1–5% of infected individuals, the acute phase can cause life-threatening fluid accumulation around the heart, or inflammation of the heart or brain and surrounding tissues. (Where have we heard that before?)
Unless treated with anti-parasitic drugs, individuals remain chronically-infected with T. cruzi after recovering from the acute phase.
Over decades, 30–40% of people develop organ dysfunction, the most common of which is heart disease. People with Chagas heart disease often experience heart palpitations and sometimes fainting, due to irregular heart function.
IS T. CRUZI A REASON WHY ANTI-PARASITIC DRUGS ARE EFFECTIVE AGAINST COVID-19 & AGAINST THE VAXX “SIDE EFFECTS”?
I do not mean to add to the confusion about the fake pandemic, with its origins in a bioweapons program – or to its attendant forced “vaccine”, with its its Nuremberg Code-violating lack of informed consent.
However, we have long suspected that the PCR test statistics-driven plandemic was a ruse to “vaccinate the entire planetary population”, to quote Bill Gates and we have since learned that the so-called “vaccine” actually contains a more concentrated form of the weaponized spike protein than the “virus” it’s supposed to treat.
Would those seeking to create bioweapons stop at a respiratory tract-infecting coronavirus? T. cruzi can survive freezing and thawing, allowing it to persist in whole blood and blood products.
An organism like T. cruzi might be a handy in a bioweapons arsenal.
Is the composition of the Franken Clot Shot even more diabolical than we thought?
As Stew says, “This sounds like an intentionally-manufactured cocktail of lethal ingredients being injected forcefully into people in certain places, coerced in other places. People are losing their jobs if they don’t get this thing and they want to lower the age group to 5 years old, to inject as many kids with this thing as possible.
“And Australia, led 24,000 people – kids – unaccompanied by parents or adults into a former sports arena, now turned into the modern-day ‘ovens’ to inject these kids, multiples of which, we have unconfirmed reports are dead. Parents are coming forward, people are upset about this, understandably.
He asks Dr Ruby, “Would you suspect that there would be any medical – any justifiable medical benefit to a cocktail made of these ingredients?”
She shakes her head in the negative, “There’s no disclosure. There’s no informed consent consideration provided to the people that are being forced to take this – ”
Stew interrupts, “Consideration means, nothing anymore. They’re not even a part of considering, in many cases whether or not they are given the choice to take this.
“They are just being told, ‘Take it or be out of a job. Take it or be court-martialed,’ in the military. ‘Go to jail. Go to the brig if you don’t take this thing.'” "
Contributed by Alexandra Bruce
My question about the parasite being found in the vaccine is how could it live in the vials? I tried to find information that could support that premise and haven't found it yet. Parasites can become dormant so would that be the mechanism of survival in the vial. The other thought is that that these organisms have been altered in some way that would allow for activation once entering a living biological environment.
I did find something in my research. I have read that people that have taken the vaccines are having herpes flare ups and recurrance of shingles ect. Here is an interesting article that might give insight into this.
Fighting parasitic infection inadvertently unleashes dormant virus
By Michael C. Purdy June 26, 2014
https://source.wustl.edu/2014/06/fighting-parasitic-infection-inadvertently-unleashes-dormant-virus/
I know this is a tad off topic but fits nicely with the topic at hand.
RunningDeer
8th September 2021, 01:10
Dr. Robert Young: What's In COVID Shots, WHY Graphene, WHO is Responsible (32 min)
Dr. Robert Young joined Stew Peters for an EXCLUSIVE, very candid conversation about his past, along with his findings after he examined the Pfizer, Moderna, J&J and Astrazeneca vials containing the "secret" contents of the COVID shots being called “vaccines"
source (https://rumble.com/embed/vjlctp/?pub=8y5b7)
vjlctp
jaybee
8th September 2021, 08:48
Dr. Robert Young: What's In COVID Shots, WHY Graphene, WHO is Responsible (32 min)
Dr. Robert Young joined Stew Peters for an EXCLUSIVE, very candid conversation about his past, along with his findings after he examined the Pfizer, Moderna, J&J and Astrazeneca vials containing the "secret" contents of the COVID shots being called “vaccines"
source (https://rumble.com/embed/vjlctp/?pub=8y5b7)
vjlctp
Absolutely fascinating stuff in this interview with Dr Robert Young on the Stew Peters Show...
Especially when he speaks about the whole germ theory being incorrect and that the environmental conditions of the location of the body and within the body itself are paramount - and the harmful results that we might call 'germs' or viruses are the bodies reaction to the without / within environmental conditions ... (think I've got this right, I need to listen to it all again...)
Much of modern medicine (and it's profits) becomes obsolete if they can't tout their chemicals for germs and viruses that could come from an environmental angle .. (without and within...)
Perhaps all disease + illness comes from pollution / poison / parasites ..... and the invisible pollution from the mobile phone network / smart meters etc is the biggest form of pollution facing us... but groups like Extinction Rebellion are encouraged to ignore all that and focus on fossil fuels and carbon... and the Climate Change scam is predicted to come hot on the heels of the Covid scam... continuing draconian controls and lockdowns..
It's pretty clear that the human body as we know it cannot thrive and survive in the technological world that the Global Elite has planned and that's why Transhumanism is the key for them... their genetically modified slave class can be pulled from a much reduced world population... able to withstand the un-natural environment (invisible pollution) that's created to facilitate the technology...
Dr Young speculates that the contents of the injections could be to hook all humans into the Internet of Things - (total surveillance and control.. (my words..)
I'm now thinking the 'vaccinations' are a triple whammy...
1. premature death.... depopulation
2. infertility...... depopulation
3. hooking a genetically modified human into the Internet of Things..... transhumanism
'they' need to rush the 'vaccine' agenda out as quickly as possible before more people become suspicious...
Delight
12th September 2021, 05:14
September 10th, 2021.
GRAPHENE OXIDE - NWO HORROR SHOW
Scientists Tivon & Hope return to SGT Report to share some frightening data about graphene and the globalist plan to put it in everything. How else did you think they were going to accomplish their track and trace plan for the internet of everything?
2XnG8m4yzI92
¤=[Post Update]=¤
Discusses means to neutralize effects
September 11th, 2021.
THE VAX, 5G, EMF'S & MAGNETISM -- HOPE & TIVON
Hope and Tivon return to SGT Report for the startling conclusion to our discussion about the experimental VAX, 5G, EMF's and MAGNETSIM.
wi8xEvAcmfSr/
mountain_jim
12th September 2021, 12:40
https://twitter.com/clif_high/status/1436877449342504961?s=20
1436877449342504961
RunningDeer
12th September 2021, 15:48
https://twitter.com/clif_high/status/1436877449342504961?s=20
1436877449342504961
FULLY VAXXED MAN SCANS ARM AND GETS PRODUCT NUMBER (13 seconds)
source (https://www.bitchute.com/video/ynmQRiwl0gfA/)
ynmQRiwl0gfA
Delight
12th September 2021, 19:15
DARPA AND PENTAGON CONSULTANT DR JAMES GIORDANO - THE EMOTIONAL SIMULATION
THE EMOTIONAL WORLD SIMULATION: UPLOADING YOUR OWN CONSCIOUSNESS INTO A DIGITAL WORLD
DARPA, European Human Brain Project, and Pentagon consultant Dr. James Giordano describes brain to computer interface, mind control weapons for remote monitoring and manipulation of neural circuits. As a result, the consciousness of an individual can be cloned onto their own digital avatar in a Sentient World simulation on a supercomputer. There is a direct connection between a target person and their digital avatar, so everything that happens in the real world takes place in the computer simulation. By manipulating the digital avatar in the computer simulation, a person's thoughts, beliefs, perceptions and behavior are manipulated in the real world. This is mind remote control.
12:28 James Corbett:https://www.corbettreport.com/how-the-government-predicts-the-future-inside-the-sentient-world-simulation/
Originalvideo: https://www.youtube.com/watch?v=-wqQMGNNYuA&list=PLBjetbgYFY176W6HZgJJL2qNz5fQxzB6g&index=1
XjtPtyNF5Jvq
mojo
12th September 2021, 19:53
Clay Clark presents some important questions that should be answered before one more vax is given. Bill Gates and his spiritual advisor Marina Abramovic patented the tech under 666 nomenclature why? The House of Congress introduces HR 666 why? Why call the tech in the vaccine Luciferase? This is much more than any vaccine.
https://rumble.com/vmbn19-7-epic-questions-every-american-should-be-asking-themselves-right-now.html
vjpgw9
ThePythonicCow
16th September 2021, 10:58
.
Related: Archbishop Vigano Says Vaccines are Human Sacrifice of Innocent Victims to Satan (https://www.trunews.com/stream/archbishop-vigano-says-vaccines-are-human-sacrifice-of-innocent-victims-to-satan)
Once again, Archbishop Carlo Maria Vigano addresses us, with the speech that I have reposted at Archbishop Viganò: Considerations on the New World Order (https://projectavalon.net/forum4/showthread.php?116299-Archbishop-Vigan---Considerations-on-the-New-World-Order).
ThePythonicCow
19th September 2021, 22:56
Are There Parasites in the Pfizer "Vaccines"?
A 50 micron elongated body, as seen in Figure 13 is a sharp mysterious presence in the Pfizer vaccine. It appears and is identified anatomically as a Trypanosoma cruzi parasite ...
It looks like the answer is a firm yes.
Let me connect four dots, and allow you to reach your own conclusions.
Dot #1) From https://en.wikipedia.org/wiki/Chagas_disease:
Chagas disease, also known as American trypanosomiasis, is a tropical parasitic disease caused by Trypanosoma cruzi. It is spread mostly by insects known as Triatominae, or "kissing bugs". The symptoms change over the course of the infection. In the early stage, symptoms are typically either not present or mild, and may include fever, swollen lymph nodes, headaches, or swelling at the site of the bite. After four to eight weeks, untreated individuals enter the chronic phase of disease, which in most cases does not result in further symptoms. Up to 45% of people with chronic infection develop heart disease 10–30 years after the initial illness, which can lead to heart failure.[2] Digestive complications, including an enlarged esophagus or an enlarged colon, may also occur in up to 21% of people, and up to 10% of people may experience nerve damage.
Dot #2) From https://www.intechopen.com/chapters/52895
Trypanosome parasites ... samples ... labeled and dipped into a vapor shipper liquid nitrogen cylinder for transportation ... with temperature in the range of –60 to –80°C.
Dot #3) From https://www.researchgate.net/publication/285417680_
STORAGE_OF_TRYPANOSOMA
Trypanosome-blood preserved at room temperature was both viable and infective for up to six hours
Dot #4) From COVID-19 VACCINE INGREDIENTS (Published :August 31, 2021•Updated :September 19, 2021) (https://nobulart.com/covid-19-vaccine-ingredients/)
Pfizer COVID-19 vaccines contain Trypanosoma (parasite).
The recommended temperature range for storage and transportation of Pfizer’s chimera is -70°C±10°C and the maximum room temperature storage time is indicated as being no more than 6 hours.
There are reported outbreaks of Chagas and of another Trypanosoma caused disease, African sleeping sickness.
Blood donation centers have tested blood from vaccinated donors positive for the Trypanosoma parasite, before they stopped accepting vaccinated donors entirely.
Some of the symptoms that are both possible side effects of "COVID-19", according to the CDC and WHO, and possible symptoms Chagas or Sleeping sickness include:
fever, fatigue, rash, body aches, headache, nausea, voiting, difficulty swallowing, joint pains, sensory disturbances and poor coordination.
=== ===
Thanks to COVID-19 VACCINE INGREDIENTS (Published :August 31, 2021•Updated :September 19, 2021) (https://nobulart.com/covid-19-vaccine-ingredients/) for providing and connecting the above dots.
=== ===
End of chapter quiz:
Why did Pfizer require transport at –60 to –80°C. (that is, at -70°C±10°C)?
Why did Pfizer allow room temperature storage just before use for only up to 6 hours?
Why are there unusual outbreaks of Chagas and African sleeping sickness in vaccinated areas?
And, what else could explain Robert Young's report last month (I almost forgot to mention the pièce de résistance) that careful laboratory analysis the Pfizer COVID-19 vaccine found that it contained "the blood parasite, Trypanosoma cruzi (Chagas disease) or possibly Trypanosoma brucei (African sleeping sickness)", as he reported in COVID-19 VACCINE INGREDIENTS (Published :August 31, 2021•Updated :September 19, 2021) (https://nobulart.com/covid-19-vaccine-ingredients/)?
=== ===
The take-away (mind you, I am not a Doctor, Lawyer, nor Indian Chief, and I did not stay at a Holiday Inn last night):
If you had the Pfizer vaccine, get checked for Trypanosoma parasites. They can cause heart disease, death, and other illnesses, years, even decades, later.
May everyone reading this be among the fortunate who received a placebo instead.
Gwin Ru
23rd September 2021, 14:40
...
... Karen Kingston: the one who tracked down where the graphene oxide (https://projectavalon.net/forum4/showthread.php?115576-Graphene-in-the-vaccines&p=1441631&viewfull=1#post1441631) was camouflaged under.
Mel Welcomes Brilliant Pharma Analyst & Whistleblower Karen Kingston On Terrifying Vax Facts 9-24-21 (https://www.bitchute.com/video/0u6pbpTAr5Bh/) 52:51
Watch (https://www.bitchute.com/video/0u6pbpTAr5Bh/#video-watch)
First published at 04:40 UTC on September 23rd, 2021.
THE MEL K SHOW (https://www.bitchute.com/channel/melkshow/)
Mel K Show (https://www.bitchute.com/profile/sytoNNj84TwN/)
Karen Kingston, a former Pfizer employee and current analyst for the pharmaceutical and medical device industries, drops indisputable documentation and the truth behind the deadly and dangerous jab ingredients and how Dr. Fauci conspired with the CCP bioweapon lab in Wuhan to commit the most massive attack on humanity ever to hit America. A must see!! God Wins!
0u6pbpTAr5Bh
Sérénité
24th September 2021, 08:56
Below is a video interviewing a Doctor with 30 years experience in studying blood samples. She talks through what she has seen from blood samples in her patients.
She has taken samples from over 60 patients, most whom are reoccurring patients therefore she has been able to compare pre and post vaccine samples from the same patients and states there is a very clear and prominent change in their blood post ‘vaccination’.
Her findings include;
-Severely aggregated blood.
-Inexplainable, non organic foreign objects. The likes of which she has never in 30 years seen before.
-Cell membranes damaged in ways usually only seen in patients experiencing extreme toxicity.
-Both white and Red blood cells destroyed in ways only usually visible in chemotherapy patients.
-Unknown crystallised structures that look like they are alive, growing and expanding by the hour, interacting with nearby cells (graphene?)
-Over active cell movement, usually seen in cells defending and reacting to toxicity and typically seen in patients with auto immune issues.
https://www.bitchute.com/video/mtJH7AU8U4UO/
https://www.bitchute.com/video/mtJH7AU8U4UO/
mountain_jim
24th September 2021, 15:51
Below is a video interviewing a Doctor with 30 years experience in studying blood samples. She talks through what she has seen from blood samples in her patients.
She has taken samples from over 60 patients, most whom are reoccurring patients therefore she has been able to compare pre and post vaccine samples from the same patients and states there is a very clear and prominent change in their blood post ‘vaccination’.
Her findings include;
-Severely aggregated blood.
-Inexplainable, non organic foreign objects. The likes of which she has never in 30 years seen before.
-Cell membranes damaged in ways usually only seen in patients experiencing extreme toxicity.
-Both white and Red blood cells destroyed in ways only usually visible in chemotherapy patients.
-Unknown crystallised structures that look like they are alive, growing and expanding by the hour, interacting with nearby cells (graphene?)
-Over active cell movement, usually seen in cells defending and reacting to toxicity and typically seen in patients with auto immune issues.
https://www.bitchute.com/video/mtJH7AU8U4UO/
https://www.bitchute.com/video/mtJH7AU8U4UO/
Thanks so much Sérénité !
This post was really helpful for me - I wish more folks had time to include a somewhat detailed text summary of what can be learned from a posted video link - saves time and affects viewing priority for me.
That link has been posted at Avalon previously, but I watched first few seconds and was not impressed enough to get past the initial interviewer/presenter's face. Which was my mistake, and your summary was quite valuable for me to re-prioritize and watch this video with these starkly concerning blood details.
Journeyman
25th September 2021, 11:40
I'm not certain how, or if, this relates to the vaccines:
https://g2owatertech.com/milestone-contract-for-graphene-technology-in-water-treatment/
but having found it just after the news broke about our drinking water supply being fluoridated it's got me wondering if I need to find another source of drinking water. :(
RunningDeer
25th September 2021, 13:50
I'm not certain how, or if, this relates to the vaccines:
https://g2owatertech.com/milestone-contract-for-graphene-technology-in-water-treatment/
but having found it just after the news broke about our drinking water supply being fluoridated it's got me wondering if I need to find another source of drinking water. :(
I don’t know about graphene oxide. I used the Berkey search engine, but my internet is buffering. I’ve use the Berkey Water Filter system for 10+ years and my drinking water comes from an artisan well. I have the Travel Berkey Water Filter (https://www.berkeyfilters.com/products/travel-berkey). It has a 1.5 gallon capacity (5.7 L) and is a gravity fed system.
What Does Berkey Remove? (https://www.berkeyfilters.com/blogs/berkey-blog/what-does-berkey-filter)
What exactly does a Berkey Water Filter System filter out?
Over 200 contaminants are removed with Berkey water filter systems. We've extensively tested our filters and found our technology greatly exceeds the standards. Berkey removes contaminants from A to Z. Berkey filters go above and beyond testing standards, using EPA and state-certified labs to test above the EPA and ANSI/NSF (Std. 53) protocol. Based on the test data, Black Berkey Purification Elements (sometimes called Black Berkey Filters) elevate the system from a filter to a water purifier because it removes 99.9999999% of pathogenic bacteria (log 9 reductions) and 99.999% of viruses.
Arsenic
Yes, Berkey removes 99.9% of arsenic.
Learn more about Arsenic. Find out what it is, what is causes and how to remove it.
Bacteria
Yes, Berkey removes 99.9% of bacteria.
Including: pathogenic bacteria and surrogates such as Raoultella terrigena, Bacillus atrophaues (Anthrax Surrogate), and Salmonella Enterica.
Chlorine
Yes, Black Berkey Filters remove 99.9% and Berkey Shower Filters remove 95% of chlorine.
Learn more about Chlorine. Including the harmful byproducts such as haloacetic acids and trihalomethanes.
Chromium 6
Yes, Berkey removes 99.8% of chromium 6.
Learn more about Chromium 6 (aka Hexavalent Chromium). Read more about the dangers of this compound and how it can get in your water.
E. Coli
Yes, Berkey removes 99.9% of E. Coli.
AKA Escherichia Coli
Endocrine Disruptors
Yes, Berkey removes 99.9% of all endocrine disruptors.
Curious about what are Endocrine Disruptors? After you read that you'll know why we recommend using glass water bottles.
Fluoride
Yes, Berkey Fluoride Filters remove up to 97% of fluoride from tap water.
Glyphosate
Yes, Berkey removes Glyphosate, the main ingredient in the common herbicide, RoundUp.
Haloacetic Acids
Yes, 99.9% of all haloacetic acids (HAA5s) are removed.
Find out what Haloacetic Acids are, also known as HAA5s.
Heavy Metals
Yes, Berkey removes 99.9% of all heavy metals.
Including: Aluminum, Antimony, Barium, Beryllium, Bismuth, Cadmium, Cobalt, Chromium, Chromium 6, Copper, Iron, Lead, Mercury, Molybdenum, Nickel, Vanadium, and Zinc
Lead
Yes, Berkey removes 99.9% of lead.
Lead--What is it? How is it harmful? Why is it in your water?
Micro-Organisms
Yes, Berkey removes more than 99.9% of all micro-organisms.
Including: total coliform, fecal coliform, e. coli
Minerals
No. Because we don't want to remove minerals!
Learn more about why beneficial minerals are left in Berkey water. This excludes zinc (see below).
RELATED: Is Distilled Water Safe to Drink?
Monochloramine
Yes, Berkey removes 99.9% of monochloramine.
Read more about Monochloromine.
Nitrates
No, Berkey does not remove Nitrates because they are like a mineral. Read more...
Nitrites
Yes, Berkey removes more than 95% of nitrites.
Pesticides and Volatile Organic Compounds
Yes, Berkey removes 99.9% of all pesticides and VOCs.
Petroleum Products
Yes, Berkey removes more than 99.9% of all petroleum products.
Including: Gasoline, Diesel, Crude Oil, Kerosene, Mineral Spirits, and Refined Oil
PFAS and PFCs
Yes, Berkey removes 99.9% of all PFAS and PFCs.
What does PFAS and PFC stand for?
Pharmaceutical Drug Contaminants
Yes, Berkey removes 99.9% of all pharmaceuticals from drinking water.
Including: Acetaminophen, Caffeine, Carbamazepine, Ciprofloxacin HCl, Erythromycin USP, Sulfamethoxazole, Trimethoprim, Bisphenol A, Diclofenac Sodium, 4-para-Nonylphenol, 4-tert-Octylphenol, Primidone, Progestrone, Gemfibrozil, Ibuprofen, Naproxen Sodium, and Triclosan
Trihalomethanes
Yes, Berkey removes 99.8% of trihalomethanes.
Discover how trihalomethanes (including: bromodichloromethane, bromoform, chloroform, and dibromochloromethane) are created and why they're in majority of the U.S. water supply.
Viruses
Yes, Berkey removes 99.999% of all viruses -- far exceeding standards.
Because Black Berkey Filters remove pathogens at such a high level they are actually considered a water purifier. Learn more about the difference between a water filter and water purifier.
Zinc
Yes, Berkey removes 99.9% of zinc. This is the exception to minerals, which are mostly left in.
Journeyman
25th September 2021, 13:53
I'm not certain how, or if, this relates to the vaccines:
https://g2owatertech.com/milestone-contract-for-graphene-technology-in-water-treatment/
but having found it just after the news broke about our drinking water supply being fluoridated it's got me wondering if I need to find another source of drinking water. :(
I don’t know about graphene oxide. I used the Berkey search engine, but my internet is buffering. I’ve use the Berkey Water Filter system for 10+ years and my drinking water comes from an artisan well. I have the Travel Berkey Water Filter (https://www.berkeyfilters.com/products/travel-berkey). It's a gravity fed system.
What Does Berkey Remove? (https://www.berkeyfilters.com/blogs/berkey-blog/what-does-berkey-filter)
What exactly does a Berkey Water Filter System filter out?
Over 200 contaminants are removed with Berkey water filter systems. We've extensively tested our filters and found our technology greatly exceeds the standards. Berkey removes contaminants from A to Z. Berkey filters go above and beyond testing standards, using EPA and state-certified labs to test above the EPA and ANSI/NSF (Std. 53) protocol. Based on the test data, Black Berkey Purification Elements (sometimes called Black Berkey Filters) elevate the system from a filter to a water purifier because it removes 99.9999999% of pathogenic bacteria (log 9 reductions) and 99.999% of viruses.
Arsenic
Yes, Berkey removes 99.9% of arsenic.
Learn more about Arsenic. Find out what it is, what is causes and how to remove it.
Bacteria
Yes, Berkey removes 99.9% of bacteria.
Including: pathogenic bacteria and surrogates such as Raoultella terrigena, Bacillus atrophaues (Anthrax Surrogate), and Salmonella Enterica.
Chlorine
Yes, Black Berkey Filters remove 99.9% and Berkey Shower Filters remove 95% of chlorine.
Learn more about Chlorine. Including the harmful byproducts such as haloacetic acids and trihalomethanes.
Chromium 6
Yes, Berkey removes 99.8% of chromium 6.
Learn more about Chromium 6 (aka Hexavalent Chromium). Read more about the dangers of this compound and how it can get in your water.
E. Coli
Yes, Berkey removes 99.9% of E. Coli.
AKA Escherichia Coli
Endocrine Disruptors
Yes, Berkey removes 99.9% of all endocrine disruptors.
Curious about what are Endocrine Disruptors? After you read that you'll know why we recommend using glass water bottles.
Fluoride
Yes, Berkey Fluoride Filters remove up to 97% of fluoride from tap water.
Glyphosate
Yes, Berkey removes Glyphosate, the main ingredient in the common herbicide, RoundUp.
Haloacetic Acids
Yes, 99.9% of all haloacetic acids (HAA5s) are removed.
Find out what Haloacetic Acids are, also known as HAA5s.
Heavy Metals
Yes, Berkey removes 99.9% of all heavy metals.
Including: Aluminum, Antimony, Barium, Beryllium, Bismuth, Cadmium, Cobalt, Chromium, Chromium 6, Copper, Iron, Lead, Mercury, Molybdenum, Nickel, Vanadium, and Zinc
Lead
Yes, Berkey removes 99.9% of lead.
Lead--What is it? How is it harmful? Why is it in your water?
Micro-Organisms
Yes, Berkey removes more than 99.9% of all micro-organisms.
Including: total coliform, fecal coliform, e. coli
Minerals
No. Because we don't want to remove minerals!
Learn more about why beneficial minerals are left in Berkey water. This excludes zinc (see below).
RELATED: Is Distilled Water Safe to Drink?
Monochloramine
Yes, Berkey removes 99.9% of monochloramine.
Read more about Monochloromine.
Nitrates
No, Berkey does not remove Nitrates because they are like a mineral. Read more...
Nitrites
Yes, Berkey removes more than 95% of nitrites.
Pesticides and Volatile Organic Compounds
Yes, Berkey removes 99.9% of all pesticides and VOCs.
Petroleum Products
Yes, Berkey removes more than 99.9% of all petroleum products.
Including: Gasoline, Diesel, Crude Oil, Kerosene, Mineral Spirits, and Refined Oil
PFAS and PFCs
Yes, Berkey removes 99.9% of all PFAS and PFCs.
What does PFAS and PFC stand for?
Pharmaceutical Drug Contaminants
Yes, Berkey removes 99.9% of all pharmaceuticals from drinking water.
Including: Acetaminophen, Caffeine, Carbamazepine, Ciprofloxacin HCl, Erythromycin USP, Sulfamethoxazole, Trimethoprim, Bisphenol A, Diclofenac Sodium, 4-para-Nonylphenol, 4-tert-Octylphenol, Primidone, Progestrone, Gemfibrozil, Ibuprofen, Naproxen Sodium, and Triclosan
Trihalomethanes
Yes, Berkey removes 99.8% of trihalomethanes.
Discover how trihalomethanes (including: bromodichloromethane, bromoform, chloroform, and dibromochloromethane) are created and why they're in majority of the U.S. water supply.
Viruses
Yes, Berkey removes 99.999% of all viruses -- far exceeding standards.
Because Black Berkey Filters remove pathogens at such a high level they are actually considered a water purifier. Learn more about the difference between a water filter and water purifier.
Zinc
Yes, Berkey removes 99.9% of zinc. This is the exception to minerals, which are mostly left in.
That sounds promising!
Thanks RD :) :thumbsup:
Delight
10th October 2021, 19:15
Self organizing metallic falling from the skies
STRANGE METALLIC-LIKE MATERIAL OBSERVED AFTER RAINFALL (https://brandnewtube.com/v/zPt5TC)
RunningDeer
10th October 2021, 20:24
Self organizing metallic falling from the skies
STRANGE METALLIC-LIKE MATERIAL OBSERVED AFTER RAINFALL (https://brandnewtube.com/v/zPt5TC)
STRANGE METALLIC-LIKE MATERIAL THAT RESEMBLES
GRAPHENE OBSERVED AFTER RAINFALL (3:43 min)
Source (https://www.bitchute.com/video/YAzPOYkAdWKQ/)
YAzPOYkAdWKQ
Kryztian
11th October 2021, 03:04
Posting without comment
ZgLgQ7ySAdE
s7e6e
12th October 2021, 02:23
Health promoting "vaccines":
1) https://tv.gab.com/channel/realstewpeters/view/first-us-lab-examines-vaccine-vials-615522689e3b2c6aba8ef85b
2) https://tv.gab.com/channel/realstewpeters/view/receipts-patent-proves-vaxx-is-obedience-61649e0bb671247fe668fe85
https://rumble.com/vnm1cn-receipts-patent-proves-vaxx-is-obedience-training-platform.html
vkzv7x
gord
15th October 2021, 15:38
I wouldn't have a clue if this is relevant to anything. I just stumbled across it.
https://www.ncbi.nlm.nih.gov/pmc/articles/PMC6580932/pdf/fchem-07-00399.pdf
Graphene-Based Sensors for Human Health Monitoring
https://www.ncbi.nlm.nih.gov/pmc/articles/PMC6580932/pdf/fchem-07-00399.pdf
mojo
15th October 2021, 17:20
There seems to be more than a few things going on in the vax but so far I haven't heard anyone make a connection.
1.The black spheres (graphene oxide?)were called a possible payload but they are connecting to make something bigger?
2. The swimming organisms including the tentacled organism and nano particles (minituraized computer chips) of super conductive material.
Somehow it seems like they were making a recipe for something else. And it might not be related to the spike protein thats in there too. The big question in my mind is now that most of us have heard about this why havent the people in authority/power started an investigation to ease the publics concern??? Oh unless they know they cant tell us because if they did, they would be in jail for life right now.
Ernie Nemeth
15th October 2021, 17:46
The graphene sheets are considered 2D constructs, which explains their high affinity to electrons and thus to the immune components in the blood. The graphene sheets have the ability to move from the injected site and migrate to various organs in the body, most notably its ability to cross the blood brain barrier and affix itself to neurons. It is also known to cause cytokine storms due to its interference with the immune components in the blood.
The sheets can self-organize into larger structures. These larger structures can act as very sensitive antennae with high signal to noise ratios.The sheets are fexible and so move with the organs they are attached to, which is important because shearing caused by body movement can cause tissue damage. And because of their thinness they are excellent sensors that can give real time feed-back on the organ's function.
They can also be programmed with radio and other frequencies that can augment their usefulness.
What has been noticed in both in vitro and in vivo experiments is that the graphene sheets interfere with normal biological function. Not by damaging the cells they adhere to but by somehow interfering with the normal communication and activity of those cells. In one experiment of graphene used for monitoring brain function, it was noted that although the graphene did not seem to destroy or alter or otherwise damage the cell, even promoting more glial cell formation and dendrite connections to form, the neurons seemed unable to communicate with surrounding neurons.
While graphene promises to be a very useful tool in sensing and monitoring and eventually augmenting and repairing surrounding cells and organs, it also comes with many toxic effects that are as yet unknown in terms of long term damage. It is already being used to diagnose sugar levels, monitor heart function through blood components, relay information about brain function, and is used in a variety of wearable patches that monitor heart rate, blood serum levels, and a host of other sensing data.
Elainie
19th October 2021, 01:27
Of interest:
https://odysee.com/@CosmicAgency:c/505mb:e
https://odysee.com/@CosmicAgency:c/vaccinestaygetanlab:8
Pam
27th October 2021, 11:10
GRAPHENE Oxide in INJECTABLE LIDOCAINE?
Once again Quinta Columna has come out with very interesting information.
It appears that they have found graphene in vials of Lidocaine. There is absolutely no logical reason why you would need to put graphene in lidocaine.Lidocaine is used as a numbing agent or nerve blocking agent. Lidocaine is also used in dental procedures. I was wondering if this would happen. Utilizing any other forms of injected material to add graphene to the body.
I would be supremely suspicious of having anything injected.
https://www.bitchute.com/video/G53VharvTXMG/
sms
28th October 2021, 07:46
In this book for children:
https://galaksija.is/images/knjiga-o.jpg
The authors have explaned what is going on at these times, in a way that not only children could understand it, but some adults, as well:
https://galaksija.is/images/knjiga-1a.jpg
https://galaksija.is/images/knjiga-2a.jpg
https://galaksija.is/images/knjiga-3a.jpg
https://galaksija.is/images/knjiga-4a.jpg
https://galaksija.is/images/knjiga-5a.jpg
https://galaksija.is/images/knjiga-6a.jpg
(...)
thepainterdoug
28th October 2021, 12:56
from Orwell.
Dr. Wilfredo Stokes reveals effect of mask use on graphene oxide in blood
October 27, 2021
In a new exclusive presentation for the program Dirección Correcta on Radio El Mirador del Gallo, Guatemalan doctor and researcher Wilfredo Stokes revealed the real reason behind the imposition of the mandatory use of masks in this false pandemic.
In short, breathing foul air acidifies the blood and this acidity causes the graphene oxide circulating in the body to become reduced graphene oxide. In other words, prolonged use of face masks allows the graphene oxide to do more damage more quickly.
To listen to Dr. Stokes' explanation, refer to the following video that Orwell City has prepared.
Link: Rumble
Jorge Osorio (Dirección Correcta): You were telling me that the damage from the electromagnetic waves is not only going to influence those who are inoculated, but they will also influence people who aren't as well. Tell us more about this, doctor. Go ahead.
Dr. Wilfredo Stokes: Look, many predisposing factors make people get sicker than others. But what is it that these people put on us intentionally, without any benefit, and, apparently, as a joke? The use of facemasks.
It turns out that when we breathe, our blood becomes acidified. It's like what's 'rotten.' It's acidic. And it happens that what's called graphene —what the gentlemen of La Quinta Columna (Ricardo Delgado and Dr. Sevillano) discovered in the vials because they said it very clearly: graphene—... What does this graphene do? It can receive electrical energy, transform it, increase it, and then send it back.
So what do you call Graphene Oxide when activated? The nanomaterial comes in as graphene oxide —it's present in the vials as graphene oxide (GO)— but what happens when it's going to act? Hydrogen is added to it. An acidic hydrogen atom.
Hydrochloric acid is the same as muriatic acid. It's a very rich source of hydrogen that burns, and it's what gives the acidity.
So, when you wear a mask, and your blood becomes acidic, it activates the graphene in your blood more easily, and then it's called reduced graphene oxide (rGO).
So, that acidity that comes from wearing a mask —because you're breathing your own carbonic acid— activates and converts the graphene oxide into reduced graphene oxide faster. I have not heard anyone say this, but medicine is about knowing a little about how the body works under normal conditions.
What I'm talking about is basic biochemistry for physicians, but in the way I'm explaining it, I think many people are catching on.
If you like my articles and the videos you find here and, if you can and feel like it, you can make a small donation. Your support is always more than appreciated.
Follow Orwell City on Telegram. Thank you for reading!
—Orwellito.
gord
3rd November 2021, 16:07
As usual for this sort of thing, I wouldn't have a clue if this is relevant to anything. I just stumbled across it.
https://www.ncbi.nlm.nih.gov/pmc/articles/PMC5853756/pdf/nanomaterials-08-00125.pdf
Effects of Graphene Oxide Nanoparticles on the Immune System Biomarkers Produced by RAW 264.7 and Human Whole Blood Cell Cultures
[pdf embed didn't work]
Pam
22nd November 2021, 10:44
I couldn't find a thread on graphene alone so I thought I would add this here. A woman is pointing out that a antibiotic that was prescribed has graphene oxide in it. This is a heads up. I suspected this was going to be coming.
I wouldn't be surprised to start finding it in processed foods as well. I have no idea how well it would be digested but it is concerning.
GRAPHENE OXIDE found in PRESCRIPTION DRUG CAPS?
8HG1O8GPD4Ka
TravelerJim
22nd November 2021, 12:55
This may be posted in the wrong place, please move if best.
I have spent a lot of time on the ET phenom for 25 years now and have come to the conclusion that most of what we saw and read about were human experimentation of ET technology - I would include visible spaceships, implants, abductions, men in black etc. All that stuff would have been when ET was teaching the black ops folks or it was the black op folks doing it themselves.
Now, why am I posting that thought here? Because I think the virus/vaccine phenom was rolled out using technologies learned from ET. When you get into nano "stuff" and that sort of thing there would seem to be a connection.
So, if that is the case, there is a good chance we already have technology in our bodies from these species, and it is far more advanced, so it looks "natural" to us, even though it was added at different points. So just like the black ops folks first efforts on space ships, implants, etc., were a bit crude, the same could be said for what is happening now within our bodies.
I do wonder what it take to rid a human body of not only the crap the virus and vaccines are putting into human bodies but other foreign stuff we do not even know about. I am using IVM and Diatomaceous Earth and will add Betonite Clay shortly for this effort.
Any thoughts or ideas on this concept itself as well as any remedial actions which could be taken?
Pam
22nd November 2021, 13:38
This may be posted in the wrong place, please move if best.
I have spent a lot of time on the ET phenom for 25 years now and have come to the conclusion that most of what we saw and read about were human experimentation of ET technology - I would include visible spaceships, implants, abductions, men in black etc. All that stuff would have been when ET was teaching the black ops folks or it was the black op folks doing it themselves.
Now, why am I posting that thought here? Because I think the virus/vaccine phenom was rolled out using technologies learned from ET. When you get into nano "stuff" and that sort of thing there would seem to be a connection.
So, if that is the case, there is a good chance we already have technology in our bodies from these species, and it is far more advanced, so it looks "natural" to us, even though it was added at different points. So just like the black ops folks first efforts on space ships, implants, etc., were a bit crude, the same could be said for what is happening now within our bodies.
I do wonder what it take to rid a human body of not only the crap the virus and vaccines are putting into human bodies but other foreign stuff we do not even know about. I am using IVM and Diatomaceous Earth and will add Betonite Clay shortly for this effort.
Any thoughts or ideas on this concept itself as well as any remedial actions which could be taken?
I have a sneaking suspicion you are right Jim. I would suggest you look into NAC, glutathione and zeolite for starters. The cornerstone in my opinion is VitaminD with K2. The FDA made attempts to remove access of NAC, so that tells you something. They sure as heck weren't doing it because they care so much about us. They don't want any mode of removing this stuff. I bought it bulk in powder form took a small amount for use into a container and vacupacked the rest. I tolerate it really well and it gives me a sense of well being, which is nice. I love your idea about Diamtomaceous Earth. I have used it for flea removal on my dogs beds and fur and parasite control in my dogs. I also use it to deter snails in my garden. I might just add a bit to my regime.
Ewan
22nd November 2021, 23:45
The amount of films that have featured black goo, or some variant. Injections, eyes turning black. All in mainstream movies.
Makes you wonder.
TomKat
23rd November 2021, 00:50
Former Pfizer employee Karen Kingston says there IS graphene oxide in the mrna shots:
https://www.brighteon.com/f6336d85-8ed9-4e22-81b4-9f9fc1df7e5b
Gwin Ru
24th November 2021, 16:29
Pfizer Emails Confirm Graphene: Intentional Cover-up By Chief Scientist Revealed (https://rumble.com/vpr104-pfizer-emails-confirm-graphene-intentional-cover-up-by-chief-scientist-reve.html) 25:42
Stew Peters Show (https://rumble.com/c/StewPeters)
Published November 24, 2021 592 Views
Rumble (https://rumble.com/) — We have some new leaked emails from Pfizer. Ever since the vaccines dropped a year ago, people have been speculating they may contain graphene oxide as an explanation for mysterious side effects that have been seen. Now, though, we have internal emails that show how Pfizer discussed responding to questions about graphene oxide.
Melissa McAtee is a Pfizer whistleblower. She joins us.
vn4uvy
Arcturian108
29th November 2021, 00:26
The following video in German, with English subtitles, is presented by a European who has his doctorate in carbon chemistry, and specialized in understanding graphene oxide. He also calls it graphene "hydroxide". To summarize he says that the graphene oxide in the shots behave like razor blades, which is the reason that professional athletes are falling dead on the playing fields. The are pumping blood more quickly through their veins, which are being cut by these graphene oxide razor blades:
https://www.bitchute.com/video/Ervbi96YgrzG/
Delight
29th November 2021, 02:01
Cross posting
One more. :flower:
This is in German. To auto-translate, click Settings (the little 'gear wheel' icon) > Auto-translate > choose your language.
http://www.youtube.com/watch?v=uUWcL3SHuBc
Dr Andreas Noack died (and may well have been killed) one day after publishing this video.
X9oMvf6dbhCi
Here is one with his widow subtitled
0HUsMvQi9Rau
Nanoscale Razor Blades in Vaccine – Dr. Andreas Noack – Europe’s Leading Carbon Expert
Dr. Noack is convinced that the vaccine contains nanoscale graphene hydroxide razor blades that cut through the vein causing internal bleeding.
28th November 2021 (https://bluecat.media/nanoscale-razor-blades-in-vaccine-dr-andreas-noack-europes-leading-carbon-expert/)
Video transcript of English subtitles (quoting Dr. Noack):
“There is a professor Dr. Pablo Campra from the University of Almeira who studied the vaccines for the presence of graphene oxide using Micro-Roman Spectroscopy. It is the study of frequencies. There are frequency bands, two of those bands are important.
They show that it is note graphene oxide, but rather graphene hydroxide. I would like to explain what this graphene hydroxide is. It is mono-layer activated carbon. There are C6 rings. He found it in all samples. Every corner is a carbon atom. This is on a nanoscale.
I’ll cut this up a bit here. If it is 50nm long, there are 500 rings in a row. These are hydroxy groups (OH). In graphene oxide you have double bonded oxygen, and in graphene hydroxide you have an OH group. The electrons are delocalised (fully mobile). The piece is 50nm long but only 0.1 nm thick. These C6 structures are extremely stable. You can make brake pads out of this. It is not biologically decomposable.
These nanoscale structures can best be described as razor blades. These razor blades are injected into the body. Nano-scale, tiny razor blades. Only one atom layer thick. Relatively wide and high. They are razors, biologically not decomposable. The OH (hydroxy) groups can split off a proton. When the proton is split off, they gain a negative charge spread out over the whole system.
It is basically an acid. It suspends well in water because of the negative charge. So these are razor blades spread homogenously in the liquid. This is basically Russian roulette. You can see it very clearly in this woman. It cuts the blood vessels. The blood vessels have epithel cells as their inner lining. The epithel is extremely smooth. like a mirror. And it is cut up by these razor blades. That is what’s so dangerous.
If you inject the vaccine into a vein, the razors will circulate in the blood and cut up the epithel. The mean thing is that toxicological tests are done in Petri dishes. And there you will not find anything. These are the sharpest imaginable structures because they are only one atom layer thick.
This is a huge molecule which is extremely sharp. I am a specilist in activated carbon. In my doctoral thesis, I have converted graphen oxide to graphene hydroxide. I joined the world’d leading activated carbon manufacturer. After a year I was in charge of new activated carbon products. We bought a small company in Durham, near Newcastle, England. I was in charge of “new carbon products”, Europe-wide. I was in application scouting.
If you perform an autopsy on the victims, you will not find anything. Toxicologists do their tests in Petri dishes. They can’t imagine that there are structures that can cut up blood vessels. There are pictures of coagulated blood coming out of the nose. People bleed to death on the inside. Especially the top athletes who are dropping dead have fast flowing blood. The faster the blood flows, the more damage the razors will do.
As a chemist, if you inject this into the blood, you know you are a murderer. It’s a new material, toxocologists are not aware of it yet. Suddenly it makes sense that victims look like this. And that top athletes with high blood circulation, completely healthy, suddenly drop dead. You see people collapse immediately after vaccination and have a seizure. These people had bad luck in the Russian roulette. Very likely, a vein was hit by the syringe.
The question you have to ask politicians and the question doctors should ask Pfizer, is: Why are these razor blades in the vaccine?
Now they want to force vaccinate children from the age of 5.
This guy is Dr. Szekeres, president of the Austrian medical board… [see video]
“Off-label” means the vaccination is not approved. Yet they inject it already.
You can only call this a death shot at this point.
[Dr. Szekeres speaks]
A pediatrician? Do you think a pediatrician understands what graphene oxide is? There is another interview where he says he thinks it is “good” from a medical standpoint to vaccinate the population by force. An important concept in science is disputation. A scientific debate. The basis of medicine or pharmaceutics is chemistry. This doctor has no idea about chemistry.
Completely new substances unknown to nature are brought in (with the vaccines). Everyone is talking about the messenger RNA which has complex effects. Th etheory of mRNA is complex. But every chemist understands what this (the graphene hydroxide) does.
You see the mRNA story is possibly a diversion.
I cannot imagine anyone will be able to give me as a carbon specialist a proper explanation why these carbon razor blades are in the vaccine.
This is war.
They distract us with the messenger RNA. But people cannot collapse that quickly from that, right after the injection. Something else is going on. And thsi effect should be studied.
He claims to be a specialist. Apparently the Austrian doctors don’t have a smarter guy than this one [pointing to Dr. Szekeres]. He is a doctor who doesn’t understand chemistry, or is he a criminal, or he is a mass murderer.
After the Spanish doctor’s study it is official that nanoscale graphen (hydr)oxide is in the vaccine. So it is clear that razor blades are injected. So he is probably incompetent. If you want to inject a whole population by force, you have to do your homework extremely carefully. Because if there is something wrong in the injection you will kill the whole population of a country. You have to weigh the risk. How dangerous is corona? How dangerous is the injection?
This guy wonders whether people should be tied up before being injected. And he’s the top doctor. Are the doctors in Austria so incompetent that they don’t understand the basic chemistry medicine is based on?
Then they should surrender their license!
Any doctor in austria, who, after this information is now public, continues to inject this, is a murderer.
I am not some guy in the carbon field. I doctored in this area. I worked for the world’s biggest carbon manufacturer. In the area of new carbon products, I was the only expert in Europe. I’m pretty much the only European who visited other experts in Pittsburgh.
After this I started my own activated carbon company. I resinified paper and turned it into activated carbon membranes. You could cut your hands with this charred paper. It was extremely sharp. I have a good idea of what the graphene hydroxide does.
It is Russian roulette.
Do you hit the vein or not?
Does it stay in the muscle? Then it is less toxic.
But if you hit a vein, and the batches contain different amounts of GHO, then you have to know you are cutting people from the inside. And it is a highly intelligent poison. Because a normal toxicologist who works with Petri dishes, cannot find it, because it doesn’t move. Toxocologists just don’t expect any nonoscale razors.
But I can say as a chemist that we are absolutely certain that graphene hydroxide is in there. These are nanoscale razor blades. Now they want to inject children with these nano-sized razors.
I want Dr. Szekeres to explain what these razor blades are doing in these injections. And he needs to explain this to his boss Mr. Schallenberg (Austrian Chancellor), too. He’s probably a consultant for the Austrian prime minister Mr. Schallenberg.
Mr. Schallenberg, who is a lawyer, is responsible for choosing the right consultants. If he imposes this vaccine mandate on all of Austria he HAS to select the right consultants. He’s a lawyer, he doesn’t know medicine. But it’s his job to select competent consultants. And he is responsible if he selects incompetent consultants.
As a chemist, I vouch for the fact that these are nanoscale razor blades.”
…up to 13:01 – tbc
Please note there are unconfirmed reports that Dr. Noack was attacked and murdered since the publication of the video above. We sincerely hope this is not true, and when we have more info on this we will post it here.
Campra paper – DETECTION OF GRAPHENE IN COVID19 VACCINES
https://filedn.com/lNcSErof1HQYvaQ3T6q9gBJ/Nov%202021/FINAL_VERSION_CAMPRA_REPORT_DETECTION_OF_GRAPHENE_IN_COVID19_VACCINES.report.pdf
https://www.researchgate.net/publication/355979001_DETECTION_OF_GRAPHENE_IN_COVID19_VACCINES
#Dr-Andreas-Noack #Graphene-Hydroxide #Nanoscale-razor-blades #Pablo-Campra-Graphene-Paper
[/QUOTE]
yelik
29th November 2021, 13:30
I am mindful the elites are masters in the art of deception and inversion of truth. They have successfully filled the internet with misinformation, confusion and fear which can then be used to hide the truth and discredit any so called conspiracy ideas that question big pharma motives and the official narrative which is ramping up by the day.
I’m not saying this Spanish research is right or wrong – I hope it is wrong for everyone’s sake. For me I find it difficult to believe the medical mafia would be so blatant as to lace a vaccine with 99% graphene oxide knowing that research scientists would sooner or later detect it, I think technology is probably well beyond this. Not only that we might expect to see a lot more deaths and seriouis sickness which would again be too obvious to ignore – unless this new SCARIENT can be used as a cover.
I’ve heard numerous explanations about what this vaccine is or is not.
Some say
It is not a vaccine and is registered as a biological product
It is not a vaccine but gene therapy which has the potential to modify our DNA
It is both a vaccine and gene therapy – transhumanist agenda (quite possible)
The SARS-Covid virus has not been isolated or proven to exist
Spanish researchers claim it contains 99.9% graphene oxide which is highly toxic and triggers inflammation in our lungs, heart and brain.
The vaxxed are the super spreaders – which makes some sense because countries with the highest vaccination rates such as Israel, Gibraltar and Seychelles and so on have the highest growth in covid cases – which does not mean you are ill.
If it is true that the SARS -Covid virus has not be isolated or proven to exist & the PCR is a fraud and, history tells us we trust the establishment at our own peril then whatever the truth it appears to me we are unlikely to vaccinate ourselves out of this conundrum because the vaccine may well be prolonging this game of wealth stripping and control agenda 21
Also as Bill points out graphine is likely being used as part of new drugs delivery systems
https://www.dovepress.com/applications-of-graphene-and-graphene-oxide-in-smart-druggene-delivery-peer-reviewed-fulltext-article-IJN
The interview with the Pfizer whistleblower is not conclusive and misleading because the so called Pfizer emails only confirm minute fragments of graphine may find there way into the vaccine contents, that's not 99.9%. The devil is always in the detail
Blastolabs
29th November 2021, 16:46
I’m not saying this Spanish research is right or wrong – I hope it is wrong for everyone’s sake. For me I find it difficult to believe the medical mafia would be so blatant as to lace a vaccine with 99% graphene oxide knowing that research scientists would sooner or later detect it, I think technology is probably well beyond this. Not only that we might expect to see a lot more deaths and seriouis sickness which would again be too obvious to ignore – unless this new SCARIENT can be used as a cover.
That is what I have been thinking. Putting graphene oxide in the vaccines guarantees that you will be caught eventually, and removes any hope of plausible deniability.
This is NOT how these types of people normally function. It seems more likely that they have been very clearly about what is in the shots, spike proteins. This leaves them plenty of room to deny responsibility.
yelik
29th November 2021, 18:07
I’m not saying this Spanish research is right or wrong – I hope it is wrong for everyone’s sake. For me I find it difficult to believe the medical mafia would be so blatant as to lace a vaccine with 99% graphene oxide knowing that research scientists would sooner or later detect it, I think technology is probably well beyond this. Not only that we might expect to see a lot more deaths and seriouis sickness which would again be too obvious to ignore – unless this new SCARIENT can be used as a cover.
That is what I have been thinking. Putting graphene oxide in the vaccines guarantees that you will be caught eventually, and removes any hope of plausible deniability.
This is NOT how these types of people normally function. It seems more likely that they have been very clearly about what is in the shots, spike proteins. This leaves them plenty of room to deny responsibility.
I agree
Having listened and studied this stuff it is quite apparent to me this agenda has little to do with public health but rather Agenda 21 / 2030 totaL control and has been meticulously planned for quite some time, maybe decades.
What if most world leaders were the first to receive this transhuman technology - it might explain their lack of empathy, unwavering and relentless vaccine rollout regardless of consequences, death toll and adverse effects. Seeing governments became so tyrranical and hell bent on destruction in such a short period of time is definately not the way of a normal human.
We are witness to high levels of spiritual wickedness in high places which has all the hallmarks of an AI controlled mindset - all in plain sight
Gwin Ru
30th November 2021, 01:04
Graphene Oxide Wireless Network: Bioweapon Shots Contain Wireless Nanosensor (https://rumble.com/vpzbzp-graphene-oxide-wireless-network-bioweapon-shots-contain-wireless-nanosensor.html) 14:21
Stew Peters Show (https://rumble.com/c/StewPeters)
Published November 29, 2021 363 Views
Rumble (https://rumble.com/) — On this show we’ve repeatedly mentioned the work by “La Quinta Columna” in Spain. That name means “the Fifth Column,” and it’s a group of dissident researchers who have investigated these vaccines. Most importantly, they’re the ones who studied a vaccine sample and found graphene oxide in it.
Dr. Pablo Compra joins us.
vnd5vj
Shadowman
1st December 2021, 06:50
Hi all,
Well worth a look at the vids linked below regarding German Dr Andreas Noack's recent untimely passing (not unlike the passing of Kary Mullis and several president's from Haiti and Africa) after publishing an interview wherein he discussed the possibility of the Graphene Oxide nanoparticles in the waxxine acting like razor blades on the endothelial lining of arteries and veins.
Then consider that some are stating that emf frequencies (5g?) can activate movement and self assemblage of this substance to form strings 50nm long by 0.1 nm wide, enabling the GO to act like internal swords, causing internal bleeding, heart attacks, strokes, etc.
Some are also reporting that the waxxed are now emitting blue tooth frequencies or magnetic anomolies.
While his death is unverified at this time, his partners video in German seems authentic. She mentions the power going out a few hours after publishing the video online when Andreas began experiencing symptoms downstairs while getting a snack. Combined with his behaviour and symptoms she describes, I believe this was a DEW attack. Andreas was familiar with this technology and went ahead despite the personal risks.
He was also raided by the "Gestapo" in Nov 2020 during a Livestream.
https://brandnewtube.com/watch/the-dr-andreas-noack-video-regarding-vax-micro-razor-blades-rip_C4NTOcppLnzCvRy.html
http://www.youtube.com/watch?v=TbmyGPPZIqY
http://www.youtube.com/watch?v=UM6bv50TNHs
Well Done Brave Lightworker, welcome to Heaven.
Respect/Namaste
SM
Eric J (Viking)
1st December 2021, 11:49
I think this chaps been taken out!!! Grrrrr...
MURDER! Just Hours After Publishing the Secret of the Vaxx, Dr Noack is DEAD
On November 18, 2020, well-known German chemist and one of the EU's top graphene experts, Dr Andreas Noack was arrested by an armed police unit in the middle of his YouTube livestream.
On November 26th, 2021, just hours after publishing this latest video about graphene oxide and graphene hydroxide, he died suddenly.
In this video, he reveals that that Dr Pablo Campra from the University of Almeria had recently done a Micro-Raman spectroscopy study of the vaxxine and had discovered that the graphene detected in the vaxx was not graphene oxide (GO) but graphene hydroxide (GHO), which is an extremely stable molecule that is not biodegradable, so it basically stays in your system forever.
This is very bad news for vaxxine recipients, because he describes graphene hydroxide molecules as "the sharpest imaginable objects because they are only one atom layer thick...a huge molecule which is extremely sharp."
In other words, the graphene hydroxide molecules in the vaxx behave like nano razors that cut the epithelial lining of recipients' veins, which he believes is the cause of blood clots and the sudden deaths observed in so many top athletes, lately.
He believes it's a case of "Russian Roulette", where the syringe administering the intramuscular injection will inadvertently pierce a vein, allowing the GHO to enter the bloodstream, slicing up the epithelia in the blood vessels of hapless recipients.
He says here, "Do you hit the vein or not? Does it stay in the muscle? Then it is less toxic. But if you hit a vein and the batches contain different amounts of GHO, then you have to know you are cutting people up from the inside."
Sadly, he says most doctors are not familiar with these new nano materials and they have no idea of the damage that they can do to the human body and graphene hydroxide does not show up in toxicology tests.
He says of Austria, "They are the first to impose a vaxxine mandate. They are killing the whole Austrian nation. Mr Schallenberg is responsible for this. He needs the right consultants. We had an Austrian once who brought suffering and death over Europe. I am appealing to you to share this video on all channels.
"Mr Schallenberg needs thousands or hundreds of thousands of letters. He must know this is a razor, this is a means to kill. And if he knows this and he continues, he is a mass-murderer. He will walk in Hitler's footsteps."
His pregnant partner has since posted videos in which she states her belief that he may have fallen victim to an attack with some kind of a radiological weapon, since she says he had talked about "them" having this kind of technology.
Viking
Hi all,
Well worth a look at the vids linked below regarding German Dr Andreas Noack's recent untimely passing (not unlike the passing of Kary Mullis and several president's from Haiti and Africa) after publishing an interview wherein he discussed the possibility of the Graphene Oxide nanoparticles in the waxxine acting like razor blades on the epithelial lining of arteries and veins.
Then consider that some are stating that emf frequencies (5g?) can activate movement and self assemblage of this substance to form strings 50nm long by 0.1 nm wide, enabling the GO to act like internal swords, causing internal bleeding, heart attacks, strokes, etc.
Some are also reporting that the waxxed are now emitting blue tooth frequencies or magnetic anomolies.
While his death is unverified at this time, his partners video in German seems authentic. She mentions the power going out a few hours after publishing the video online when Andreas began experiencing symptoms downstairs while getting a snack. Combined with his behaviour and symptoms she describes, I believe this was a DEW attack. Andreas was familiar with this technology and went ahead despite the personal risks.
He was also raided by the "Gestapo" in Nov 2020 during a Livestream.
https://brandnewtube.com/watch/the-dr-andreas-noack-video-regarding-vax-micro-razor-blades-rip_C4NTOcppLnzCvRy.html
http://www.youtube.com/watch?v=TbmyGPPZIqY
http://www.youtube.com/watch?v=UM6bv50TNHs
Well Done Brave Lightworker, welcome to Heaven.
Respect/Namaste
SM
ExomatrixTV
2nd December 2021, 00:20
Dr. Andreas Noack Graphene Razor Blades:
yaAo6J92Kxp1
Frankie Pancakes
2nd December 2021, 12:33
America’s Frontline Doctor Reveals How To Detoxify From Graphene Oxide
https://rumble.com/vq09jj-americas-frontline-doctor-reveals-how-to-detoxify-from-graphene-oxide.html
vne3fd
Shadowman
4th December 2021, 23:25
Stefan Reich on Bitchute has now posted a video of Dr Noack's partners update with English subtitles;
https://www.bitchute.com/video/TEY9EGmDRkkl/
TEY9EGmDRkkl
Pam
5th December 2021, 14:55
HIGH SUSPICIONS of GRAPHENE Oxide in SALINE SOLUTION (Quinta Columna)
This is so weird to find. I have been using a saline spray in my nose recently due to the dry conditions of heating the house for winter. I double checked the ingredients as I am becoming very suspicious of substances in anything that is a manufactured product. I had thought about this as being a great way administer toxins, then I laughed at my paranoia.
Well, maybe the suspicion was not so weird as I thought. If graphene is being put in saline bags which are generally used for IV fluid and drug administration, that would be insane.
FrTCdQF9kxqc
DNA
5th December 2021, 19:49
Dr. Andreas Noack Graphene Razor Blades:
yaAo6J92Kxp1
This is a great video. Bless this doctors heart and bless his family. They killed him for this video.
https://www.infowars.com/posts/german-doctor-murdered-hours-after-exposing-graphene-hydroxide-in-vaccines-see-video-here/
Delight
13th December 2021, 01:11
FYI
Graphene Quantum Dots can penetrate the cell barrier and cleave DNA
DECEMBER 06, 2021 (https://www.orwell.city/2021/12/GQD.html)
J.L. (Mundo Desconocido): Identification of patterns in the blood of vaccinated persons: graphene quantum dots. The so-called GQDs.
OK. Take a look at the following images. In them, you can carefully observe some red blood cells, erythrocytes, blue in color with a ring shape. But in addition to these red blood cells, red cells are in the shape of a ring, there are other elements are not clearly identified. They're or are shaped like luminescent dots, and they're variable in size. After considering these images and contrasting their morphology, we have come to the collection or conclusion that they are graphene oxide quantum dots, also called GQDs (Graphene Quantum Dots) or GOQDs (Graphene Oxide Quantum Dots).
Why do we say that?
The first shred of evidence is found in this work we're showing you. It was carried out in 2011. And in it, you can see how the molecules are transformed (C60 carbon molecules) into something known as fullerene. In what can be called graphene quantum dots. The fullerene is a spherical molecule of graphene. A structure of 20 hexagons and 12 pentagons. But let us continue with these works. The microscopic characterization was carried out with the STM (scanning tunneling microscope). In the investigations of this work in 2011, we found graphic evidence that when we decompose the C60 fullerene into graphene quantum dots with a hexagonal shape. A very concrete image is formed in which we can see that the patterns observed in the blood show an almost exact coincidence with the one we have been able to see in the sample image.
So, the scientific literature shows us that what we're seeing there are indeed graphene quantum dots. Because these quantum dots have small dimensions, a few nanometers, and have a kind of retention on the luminescent properties, they can be clearly identified. As can be seen here in the image marked with red circles. The existing similarity is undeniable. Even the TimTruth documentary in 2021, in which a series of researchers consisting of Axel Bolland, Bärbel Ghitalla, Holger Fischer, and Elmar Becker, presented themselves in the documentary and showed a spirotronic device they called "swimmer." And in those images, you could clearly identify those graphene quantum dots. You can clearly see how they appear in this image.
To all this, we must add another fundamental evidence. It can be seen how these graphene quantum dots conduct a penetration into the blood cells. The evidence can be found in the following image. Let's say that, in this image, we can see in point A and point B. And how in A, the graphene quantum dot tries to access the interior of a cell. And at point B, it has already managed to access the inside of the cell. Even in the following image, you can see how, again, that quantum dot penetrates inside the cell, closely followed by several quantum dots of different sizes. The problem is bigger because, even in the image we are showing you right now, all the phases of the process can be observed. In addition to the fact that more than one graphene quantum dot can enter the cells. As you can see here.
In box C of this figure, you can see how even up to five graphene dots have penetrated inside a cell. This ability to invade cells is well documented in the scientific literature.
Here's a research paper that was specifically done in 2015 that demonstrates that its application in traceable drug delivery for targeted, acid-sensitive delivery of a chemotherapeutic drug into cancer cells. In their work, graphene quantum dots are loaded with doxorubicin for release into cells. This is perfectly reflected in the schematic in Figure 9 of their research, as can be seen here.
Further evidence is the capabilities of graphene quantum dots to invade and penetrate cells, as well as interfere with DNA. It can be seen with the images are shown here, how synthesizing graphene oxide or graphene oxide quantum dots through the photo-fenton method, convert approximately 90% of supercoiled DNA into nicked DNA, a nick being a discontinuity between the DNA helix. Therefore, we can think that these graphene quantum dots have a much higher cutting capacity than graphene oxide sheets.
Other evidence that undoubtedly demonstrates the ability of graphene quantum dots to overcome the cell wall is found in the studies carried out specifically in 2013, 2021, and 2015, which we indicate here. In fact, nanomaterials can enter cells and affect cell division, proliferation, apoptosis, and more. It was also found that graphene quantum dots of less than 5 nanometers could directly enter cells and produce toxic effects, specifically in E. coli and Bacillus substilis cells. This demonstrates the danger of graphene quantum dots, given their ability to induce cytotoxicity, inflammation, and genotoxic effects, as demonstrated in the figure you're looking at now.
The effects of the cuts produced by graphene quantum dots can be seen in the figure you're looking here. Here it can be seen more concretely. The view on the left shows a graphene quantum dot penetration and its presence inside the cell membrane. The pictures on the right show the damage produced. The opinions that we can generate in this regard are the following: By the images observed and the existing scientific literature, the existence of graphene quantum dots in the blood of vaccinated persons can be confirmed. The morphology, structure, and special characteristics, such as fluorescence, coincide with the characterization referred to in the publications in the field.
Another opinion I can argue in this regard is that graphene quantum dots can be obtained in the microwave cleavage of graphene and of C60 fullerenes, which would explain the multiplication of these elements in the blood and fluids of the human body. This poses a serious health hazard, given their cutting potential and ability to penetrate cell walls and cleave DNA.
One more point I'd like to add is that from a functional point of view, the semiconducting properties of graphene quantum dots enable them to form a wireless network through which they can monitor and even more effectively neuromodulate as nanotransducers than graphene oxide sheets. People's behavioral patterns. Images that have transcended from blood tests of vaccinated people demonstrate the presence of fractal materials of crystallized graphene, hydrogel ribbon swimmers, and graphene oxide.
And finally, graphene quantum dots. According to all the evidence and facts noticed, it can be stated that this graphene ecosystem in the human body is designed for the reception of electromagnetic signals through graphene fractal nano-antennas and their propagation through graphene quantum dots with a double purpose. On the one hand, the possible administration of drugs and their release in biological targets. That is, in certain organs of the body. And on the other hand, the modulator purpose of neurons and other tissues of the human body that could be telecontrolled by microwaves or 5G emissions.
Finally, hydrogel ribbon-shaped swimmers have a recognized motor function that operates as a function of electromagnetic waves, so it can be equally driven by electromagnetic fields and release its pharmacological or pharmacogenetic charge."
Once inside the body, graphene oxide undergoes a series of processes that allow it, eventually and among many other things, in the form of quantum dots, to break through cellular barriers and cleave DNA.
If you like the videos I subtitle and the content I post everyday on Orwell City, consider donating a small amount. Your support is always more than appreciated: https://donorbox.org/orwell-city
vnof2h
ExomatrixTV
15th December 2021, 13:39
Nano-parasites in Vaccines? (translated from Dutch).
https://sp.rmbl.ws/s8/2/o/k/6/Q/ok6Qc.caa.mp4
source (https://rumble.com/embed/vo23vc/?pub=4#?secret=Efkht0yaLa)
Anyone who has followed the reports of La Quinta Columna cannot but conclude that they have completely thrown themselves into the definition of what "vaccination" actually is.
The “vaccination” is being sold to humanity as the solution to a problem. But something is solved, but not for humanity. The real problem that will arise for the Supreme Ruler is that humanity is coming to their senses en masse and wondering what all this is good for. That is why a problem (the nonexistent “pandemic”) has been fabricated with the help of the media as an excuse to generate the solution. That "solution" was already ready, a piece of superhuman technology, processed in an injection liquid.
Humans are about ready as a genetic experiment. The next phase is ushered in. Some can continue as a bio-robot. The Supreme Ruler on duty must ensure his own safety. Because messages like this threaten to knock the bottom out of our raison d'être, we are not grateful to write about this. Then you can stop with your newspaper, then the cards have already been shuffled anyway. Then “we don't want to know” what is coming our way. But that is not an original human train of thought. That is the mindset of “the wronged person”.
Because there is so much wrong with us, people. To begin with, we are not adapted to nature. We have to protect ourselves in many ways. We often do this mindlessly by declaring war on each other in groups. Furthermore, there are inexplicable instincts, the most important of which is our moral compass, our empathic abilities. Not for everyone, but for most. For something or someone, that ability to empathize is a construction flaw that needs to be corrected. It is the last connection to our Origin that must be removed. the way it is going is beyond human comprehension, despite all efforts to ascertain the true intentions of this war against the remnants of our true Origin. Stopping our family tree and erasing our genetic memory.It is no more and no less than the removal of the last traces at the crime scene by the Criminal himself….. that's all. What should be hidden?
Fighting this evil Plan is downright suicide. It's like taking sides in a battle between two factions of the same blood type, which we're not a part of. The wicked against the benevolent…. The vast majority of humanity is excluded from that struggle, cannot make any difference, and serves as a cue ball in a game we are not playing. It is better to observe the game in the stands as an observer. On a standing place.
Nobody's property? Perhaps, but not from those who see us as their stolen property and want to use it to the fullest. The real battle is that of our Origins against the Pirate Cult that has captured humanity after a grueling Titan battle. Since then, ALL problems have been solved with destructive wars. Either with the weapons, or with propaganda, or with the Medical Mafia and their poison cup.
Let's now turn to the latest article by the Spanish gentlemen who have thrown themselves wholeheartedly at the so-called vaccines to show us how evil the "solution" to a non-problem is.
Technological Parasitism: Electromagnetic Wireless Nanosensor Network
La Quinta Columna (https://www.laquintacolumna.info/) and his collaborating scientists deepen their knowledge on a daily basis on the subject of nanotechnology being brought into the population. In the most recent program, the biostatistician Ricardo Delgado has commented on a paper that has a direct relationship to the construction of the nano-network that causes the putative vaccinations to generate MAC addresses (https://www.orwell.city/2021/11/MAC.html).
Ricardo Delgado: “ Electromagnetic Based Wireless Nanosensor Network: Architecture and Applications (https://www.researchgate.net/publication/348355577_Electromagnetic-Based_Wireless_Nano-Sensors_Network_Architectures_and_Applications) .”
Here we come very close to everything Mik Andersen (the pseudonym of a great scientist) on Corona2Inspect blog (https://corona2inspect.blogspot.com/) describes, when he all patterns in the scientific literature identified (https://www.orwell.city/2021/11/nanorouters.html) the patterns in the Pfizer vaccine -that Dr. Campra already analyzed (https://www.orwell.city/2021/11/special-program.html) -, based on the images.
If you don't know and you have been vaccinated, you should know that in your body (https://www.orwell.city/2021/12/nano-network.html) you have the artillery of nanosensors, nanotechnological nanorouters that on the one hand are going to collect all the biomedical electrophysiological markers of the person and on the other hand create an artificial neuronal network that will replace your human's own natural network. Hence, strange behavior occurs or, if you are vaccinated, you may feel particularly strange. We are talking, if you will, about technological parasitism. Of course, performed with graphene oxide.
I'm going to zoom in on it. Let's take a look at this article. This article says, “Recent advances in nanomaterials and nanotechnology have paved the way for building nanometer-sized integrated devices.”
This is where I tell you that nanotechnology has come a long way, behind the backs of civil and scientific society.
“Referred to as nano nodes.”
Unfortunately, our doctors, medics and specialists have absolutely no knowledge of this. And yet they are set up and equipped as the greatest spokespersons in the vaccinology world.
On the square nanometer….
“These nanonodes are composed of nanoprocessors, nanomemory, nanobatteries, nanotransceiver, nanoantennas and nanosensors operating at the nanoscale level. They can perform simple tasks such as detection, calculation and actuation. The interconnection between microdevices and nano-nodes/nano-sensors has enabled the development of a new networking standard called Wireless Nano-Sensor Network (WNSN). This article provides an in-depth overview of the Wireless Nano-Sensor Network (WNSN), its architectural constructs, application areas and challenges, which must be addressed while identifying opportunities for its implementation in various application domains. “
In other words, we are talking about nanotechnology recreating the communication technology we already know. But in this case in the human body. We are talking about nanocommunication. And this is the vaccine, ladies and gentlemen. The vaccines from Pfizer, AstraZeneca, Moderna and Janssen. They are all nano technology for nano communication (https://www.orwell.city/2021/12/nano-network.html). So you broadcast, the vaccinated, a MAC address in Bluetooth wireless technology (https://www.orwell.city/2021/11/MAC.html) . But you also receive signals as if you were a router.
You can view it at any time.
Recent advances in nano-materials and nanotechnology have paved the way for building integrated devices with a nanometric size, named nano-nodes. These nano-nodes are composed of nano-processor, nano-memory, nano-batteries, nano-transceiver, nano-antenna and nano-sensors, which operate at nano-scale level. They are able to perform simple tasks, such as sensing, computing and actuation. The interconnection between microdevices and nanonodes/nanosensors has enabled the development of a new network standard, called Wireless Nano-Sensors Network (WNSN). This paper provides an in-depth review of WNSN, its architectures, application areas, and challenges, which need to be addressed, while identifying opportunities for their implementation in various application domains.
https://www.researchgate.net/profile/Driss-El-Ouadghiri/publication/348355577/figure/fig1/AS:978070009815040@1610201470019/Nanosensor-architecture-4_Q320.jpg (https://www.researchgate.net/figure/Nanosensor-architecture-4_fig1_348355577)
Nanosensor (https://www.researchgate.net/figure/Nanosensor-architecture-4_fig1_348355577)
https://www.researchgate.net/profile/Driss-El-Ouadghiri/publication/348355577/figure/fig2/AS:978070009823232@1610201470060/Nanosensor-classification-according-to-the-sensing-event_Q320.jpg
Nanosensor classification according to the sensing event.
(https://www.researchgate.net/figure/Nanosensor-classification-according-to-the-sensing-event_fig2_348355577) https://www.researchgate.net/profile/Driss-El-Ouadghiri/publication/348355577/figure/fig3/AS:978070009815041@1610201470099/WNSN-interfacing-to-a-micro-gateway_Q320.jpg (https://www.researchgate.net/figure/WNSN-interfacing-to-a-micro-gateway_fig3_348355577)
WNSN interfacing to a micro gateway
(https://www.researchgate.net/figure/WNSN-interfacing-to-a-micro-gateway_fig3_348355577)
https://www.researchgate.net/profile/Driss-El-Ouadghiri/publication/348355577/figure/fig4/AS:978070009815042@1610201470153/The-WBAN-based-medical-care-in-a-hospital-environment-The-main-goals-of-WNSN-healthcare_Q320.jpg
The WBAN-based medical care in a hospital environment.
(https://www.researchgate.net/figure/The-WBAN-based-medical-care-in-a-hospital-environment-The-main-goals-of-WNSN-healthcare_fig4_348355577)The main goals of WNSN healthcare applications are to analyze, monitor, and prevent healthy bad circumstances as well as the presence of viruses on the grains, cell, or the variations at DNA level [40]. Nanosensors can be installed in the patient's environment to
https://www.researchgate.net/profile/Driss-El-Ouadghiri/publication/348355577/figure/fig5/AS:978070009815043@1610201470250/Water-quality-monitoring-architecture_Q320.jpg (https://www.researchgate.net/figure/Water-quality-monitoring-architecture_fig5_348355577)
Water quality monitoring architecture
(https://www.researchgate.net/figure/Water-quality-monitoring-architecture_fig5_348355577)--o-O-o--
Well, here's the PDF, and you can download it (https://www.researchgate.net/publication/348355577_Electromagnetic-Based_Wireless_Nano-Sensors_Network_Architectures_and_Applications) . Of course, the material that shows up here… It has to show up somewhere. It's the same old stuff. Here it is.
“Antennas, especially graphene-based.” Can you read it? I'm going to explain it here. Let's see if it allows me. “Graphene.” Here it is. To see? There is no other way.
Do you understand why they want to hide the graphene in vaccines? Or the magnetism or biomagnetism that graphene causes in the injected humans? You understand, don't you?
They deny it, of course, as any criminal wants to cover his tracks.
Logically, all those people should end up in jail.
—Orwellito.
Under an evil regime, the logic is for the criminal to be ennobled.
This shows that doctors, scientists and virologists are all stupid collaborators and ****ty followers. In fact, they don't know what they're talking about and what it's about. If they did know, it would be ignored or flatly denied. Every effort is made to eliminate the messenger as a criminal or fringe moron. Vaccination is nano-parasitism and the medical world is a pit full of poisonous viper spawn.
The reverse logic: the perpetrator is punished and the victim is given power.
source (https://herstelderepubliek.wordpress.com/2021/12/15/vaccinatie-is-nano-parasitisme)
pdf (https://www.researchgate.net/publication/348355577_Electromagnetic-Based_Wireless_Nano-Sensors_Network_Architectures_and_Applications)
ExomatrixTV
18th December 2021, 23:54
Electron Microscopy Reveals Graphene Oxide (https://rumble.com/vlonug-electron-microscopy-reveals-graphene-oxide-in-cov-19-vaccines.html) in CoV-19 Vaccines:
https://sp.rmbl.ws/s8/2/4/o/8/k/4o8kc.caa.mp4
source (https://rumble.com/vlonug-electron-microscopy-reveals-graphene-oxide-in-cov-19-vaccines.html)
Scanning & Transmission Electron Microscopy Reveals Graphene Oxide in CoV-19 Vaccines (https://www.drrobertyoung.com/post/transmission-electron-microscopy-reveals-graphene-oxide-in-cov-19-vaccines)
meat suit
30th December 2021, 18:22
putting this here to add to the debate.
for what its worth, the guy in the video shows graphene oxide is not magnetic.
https://www.youtube.com/watch?v=yEFnlJXGkiU
ExomatrixTV
7th January 2022, 01:46
871860476810064
source (https://www.facebook.com/flory.malayo.92/videos/871860476810064)
onawah
17th January 2022, 00:57
LA QUINTA COLUMNA 1-ON-1: SPANISH RESEARCHER FIRST TO REVEAL GRAPHENE OXIDE
1/15/22
https://forbiddenknowledgetv.net/la-quinta-columna-1-on-1-spanish-researcher-first-to-reveal-graphene-oxide/
"Biostatistician Dr Ricardo Delgado of the La Quinta Columna dissident research group from Spain joins Stew Peters to discuss the contents of the vaxxine vials.
La Quinta Columna was the first group to report graphene oxide, which Dr Delgado says amplifies 5G signals within the body, from gigahertz to terahertz, which he thinks, in turn powers their self-assembly into the microchips, which are also found in the vaccine, over time.
Dr Delgado says that vaccinated people therefore emit lots of radiation and that an aspect of the “shedding” phenomenon, whereby unvaccinated people are made ill in the presence of those who are vaccinated has to do with these high levels of radiation.
He says that classic COVID symptoms match those described in the scientific literature as symptoms of radiation exposure. He does not believe the virus is real and notes that it has never been isolated from a human body.
He believes COVID symptoms are largely a result of the new 5G signals that are starting to come online all over the world. These fields can sicken the unvaccinated but their effect on the vaccinated is to make them even sicker.
Stew tells him about his recent bout with what was diagnosed as COVID and how he was treated with ivermectin and other alternative medications, which he says helped him. He asks Dr Delgado if COVID isn’t real, then how could these medications help him if what he was actually suffering from was radiation exposure?
Dr Delgado responds that many of these medications have the effect of bringing oxygen into the cells and they also support the immune system, which has been triggered by the radiation.
When asked if he his found anything like what Dr Carrie Madej and others have reported; of parasites and other biological life in the vials, Dr Delgado replies that he believes that these are synthetic biology, not actual living organisms.
He says his group hasn’t yet identified everything in the vials but they have been able to positively identify some things, such as micro antennae and micro routers, which he believes are what cause some of the vaccinated to emit MAC addresses.
Way back in mid-2015, I first began reporting on the videos of Level9News, which described plans by proponents of global governance at the World Economic Forum and the Bilderberg Group (both of which are headed by Klaus Schwab) to deploy a vast “neural net” that would turn human bodies into “nodes” on the Internet of Things.
At the time, she explained that this was being controlled and coordinated by the National Geospatial-Intelligence Agency (GEOINT) but she didn’t know that vaccination would be the means by which this technology would be deployed."
vpwwx9
onawah
17th January 2022, 01:26
HOW TO REMOVE MAGNETIC GRAPHENE OXIDE FROM YOUR BODY AFTER TAKING THE VACCINE - LA QUINTA COLUMNA
January 5, 2022
https://rumble.com/vs0i2z-how-to-remove-magnetic-graphene-oxide-from-your-body-after-taking-the-vacci.html
(Hopefully there will be a transcript for this soon. Based on Dr. Zelenko's work, and he was just newly interviewed by Dr. Mercola. See: https://projectavalon.net/forum4/showthread.php?117525-The-Plandemic-and-the-NWO&p=1475972&viewfull=1#post1475972)
vpebz3
onawah
2nd February 2022, 20:30
5G POWERED GRAPHENE BASED NANO-TECH IN THE PFIZER VACCINE
2/2/22
https://forbiddenknowledgetv.net/5g-powered-graphene-based-nano-tech-in-the-pfizer-vaccine/
"This latest Greg Reese video about the findings of La Quinta Columna (the Fifth Column) is of interest for both the injected and the non-injected, because we all need to know what is in them and their potential effects. Those who are able to survive the procedure may find they are no longer in control of their own will.
***
TRANSCRIPT
The Fifth Column recently published their findings and conclusions on the strange, self-assembling nanotech they discovered in the Pfizer mRNA vaxxines via optical microscopy analysis.
The objects they found in the vaxxine correspond with known items in the scientific record and the conclusion they come to seems quite clear: that the well-documented scientific goal to use nanotechnology in living human beings to form networks capable of controlling several nano machines is currently being deployed in the CoV-19 vaxxines, which amounts to the most intrusive assault against humanity in all of recorded history.
While the media and Government lie and cover for Big Pharma, the official ingredients are still unknown.
But we have thousands of brilliant scientists worldwide studying these experimental vaxxines. Some have died in highly-suspicious ways but most have been able to share their findings and the work shows us that graphene oxide is a key component in all of this.
There have been dozens of official documented studies on the use of graphene oxide related to how we see it being used here today, among other things, as a power converter.
Graphene. The one-atom thick hexagonally-arranged carbon atoms is the thinnest and strongest material known to man and an outstanding conductor of heat and electricity.
It can boost gigahertz frequencies into terahertz, which is exactly what these nanotech machines need for power.
In order to do this, the graphene first needs a frequency to power it and the optimal frequency to externally power graphene is known to be 26 GHz, which is also the frequency put out by 5G.
In this model, the graphene within the body is activated by microwave signals in the gigahertz range, which it then boosts into the terahertz range, which then powers the novel nanotech machinery to self-assemble within the human body.
Once assembled, what do these nanotech machines do?
The images, compared to the scientific literature suggest that they are the foundation of an internal electronic system, with endless potential for biomanipulation of the human host.
Nano routers then emit MAC addresses, able to be registered via Bluetooth. Nano and plasma antennas, to amplify signals. Nano rectannnas, to act as rectifier bridges from AC to DC current, codecs and logic gates for encryption of communications.
The raw material for all this self-assembly is also graphene oxide, and when we compare known side effects of graphene oxide to the side effects of the CoV-19 vaxxines, we find them to be the same.
Once graphene oxide is injected into the body, it acquires magnetic properties, predictably, beside the injection site, the heart and the brain.
Graphene is seen as a pathogen by our immune system and will often result in paralysis and stroke. Graphene is known to cause blood clots and heart conditions.
Graphene oxide can generate small discharges, causing cardiac arrhythmia.
There is so much going on with these experimental vaxxines and the evidence seems clear that a mass experiment is going on, with certain batches marked more deadly than others.
And certain batches contain a bold new technology, akin to a manmade parasite, intended to control the host human, if it doesn’t kill them first, in the process.
Perhaps that is what the mad scientists and psychopaths are after: human genetics that can withstand this invasive and deadly nanotech."
vr6v2k/?pub=ijro7
Hermoor
8th March 2022, 21:16
When this appalling vaccination business started I said I wouldn't even trust an aspirin or a paracetamol from these pharmaceutical companies any more. They can sneak anything in to anything nowadays, especially on a nano scale.
We can't confirm this is graphene in the following video, but we also can't confirm it is anything healthy or natural either.
https://twitter.com/BBlues60/status/1501227704087023620?cxt=HHwWiMCo0ZOpt9UpAAAA
This is about the fifth video I've seen from five different pill products all showing something strangely magnetic within them. Be on your guard with all pharmaceutical products.
TomKat
18th April 2022, 16:47
Video purporting to show how graphene has caused malformation of red blood cells in jabbed as well as unjabbed, by contagion.
https://rumble.com/v112z2q-graphene-is-being-transmitted-from-vaccinated-to-the-non-injected-destroyin.html?mref=6zof&mc=dgip3&ep=1
Philippe
19th April 2022, 07:43
Video purporting to show how graphene has caused malformation of red blood cells in jabbed as well as unjabbed, by contagion.
https://rumble.com/v112z2q-graphene-is-being-transmitted-from-vaccinated-to-the-non-injected-destroyin.html?mref=6zof&mc=dgip3&ep=1
Hereby some time-marks for this impressive video that confirms many other videos (I did not listen till the end)
15:00 shedding on a child
31:30 shedding on the sister
38:20 shedding from not-vaxed to other not-vaxed
42:40 pregnant wife can not be protected against shedding
They see no solution for avoiding shedding. A video by La Quinta Columna gives solutions with many anti-oxidants that can stop the activity of the graphene oxide. That may be useful to take if you come in close contact with a public of vaxxed persons (avoidance is quasi impossible) .
What is still missing in all these videos is information in which countries or regions the shedding is happening. The probable use of high quantities of placebos and different dosages in the injections has been impeding the research to get a clear picture.
TomKat
25th April 2022, 12:40
Murder of German graphene hydroxide expert by police.
https://seemorerocks.is/german-whistleblower-dr-andreas-noack-was-murdered/
Matthew
25th April 2022, 12:47
Murder of German graphene hydroxide expert by police.
https://seemorerocks.is/german-whistleblower-dr-andreas-noack-was-murdered/
This is very sad. Here's an extract from the article 😢
It seems that I was wrong and that Dr. Andreas Noack did not have a “heart attack” but was MURDERED shortly after making his video.
WIFE OF DR ANDREAS NOACK REPORTS HIS MURDER 4 DAYS AFTER VID ON NANO-RAZORS OF GRAPHENE HYDROXIDE
English transcript (English subtitles on video by Stefan Reich)It is Saturday, Nov. 27, 2021 [in Germany].Tuesday, Nov. 23, 10 A.M., the video about Graphene Hydroxide was published [https://www.bitchute.com/video/3qRyTCSeeAac/]. The video hit like a bomb. At the same time, Andreas had a Zoom call with someone (sorry, I didn’t recognize the name). I operated the camera and followed the chats. The interview took about two hours. After this, we had some exchanges and told each other how much we loved each other and laughed.
Shortly afterwards, Andreas was attacked brutally [apparently by German police who came to his home ]. The assault was extremely sneaky and unexpected. I have the terrible job to tell you that sadly, Andreas did not survive the assault. The news is extremely shocking for all of us. But Andreas is in me and I am a part of him. We are one.
All information is out there. We know everything we have to know. I need all of you now… It is now time for action. It is now time to believe. We have to implement his plan now. We have nothing more to lose. It is about all of humanity. He did it for you. He died for you. He was not afraid of death, he accepted the possibility. It’s horrible that it had to happen this way. It wasn’t the plan for him to leave us this quickly. As I said, assume the enemy’s energy. We must use this energy now. Turn it against them. Use it for us. I need you guys now. I can’t do it alone. Please get going.
...
https://seed132.bitchute.com/FPuXuQf53s7M/TPZwCxnVVw5W.mp4
Isserley
12th August 2022, 10:38
Scientists have discovered that an enzyme found in horseradish called horseradish peroxidase can successfully break down graphene oxide. The abstract of the study states: “In the presence of low concentrations of hydrogen peroxide (~40 μM), HRP catalyzed the oxidation of graphene oxide, resulting in the formation of holes in its basal plane. In the same analysis period, HRP failed to oxidize chemically reduced graphene oxide (RGO).” Horseradish peroxidase appears to act on graphene oxide but not on reduced graphene oxide.
Study link: https://pubmed.ncbi.nlm.nih.gov/21344859/ 🍀 Rolf Kron 🍀 Doctors, get up 🍀https://t.me/Rolf_Kron
ExomatrixTV
1st May 2023, 16:48
LSSb50xlTMLH
🆕⚠️Latest Pfizer Docs List Graphene Oxide:⚠️🆕
bit.ly/40k8i8G (https://bit.ly/40k8i8G)
⚠️Detection Of Graphene In Covid19 "Vaccines" By Micro-raman Spectroscopy - Prof. Dr. Pablo Campra Madrid⚠️
bit.ly/3HI7brG (https://bit.ly/3HI7brG)
⚠️FOIs reveal that health/science institutions around the world (211 and counting!) have no record of SARS-COV-2 isolation/purification, anywhere, ever⚠️
bit.ly/3Gt39Uq (https://bit.ly/3Gt39Uq)
⚠️A Case Report: Multifocal Necrotizing Encephalitis and Myocarditis after BNT162b2 mRNA Vaccination against COVID-19 ⚠️
mdpi.com/2076-393X/10/10/1651 (https://www.mdpi.com/2076-393X/10/10/1651)
bit.ly/3xpvS7t (https://bit.ly/3xpvS7t)
🆕⚠️Autopsy-based histopathological characterization of myocarditis after anti-SARS-CoV-2-vaccination [PDF DOC]⚠️
bit.ly/3HHQJt9 (https://bit.ly/3HHQJt9)
⚠️What is in the so-calledCOVID-19 “Vaccines”? Part 1: Evidence of a Global Crime Against Humanity:⚠️
ijvtpr.com/index.php/IJVTPR/article/view/52/121 (https://ijvtpr.com/index.php/IJVTPR/article/view/52/121)
bit.ly/3gXgQ4j (https://bit.ly/3gXgQ4j)
⚠️Scanning and Transmission Electron Microscopy Reveals Graphene Oxide in CoV-19 Vaccines⚠️
actascientific.com/ASMS/pdf/ASMS-06-1351.pdf (https://www.actascientific.com/ASMS/pdf/ASMS-06-1351.pdf)
⚠️Evidence for a connection between coronavirus disease-19 and exposure to radiofrequency radiation from wireless communications including 5G⚠️
ncbi.nlm.nih.gov/pmc/articles/PMC8580522/pdf/jclintranslres-2021-7-5-666.pdf (https://www.ncbi.nlm.nih.gov/pmc/articles/PMC8580522/pdf/jclintranslres-2021-7-5-666.pdf)
⚠️Case Briefing Document and lab report, shows GRAPHENE OXIDE FOUND IN ALL MRNA INJECTIONS, 11/02/2022⚠️
ukcitizen2021.org/Case_Briefing_Document_and_lab_report_Ref_AUC_101_Report%20.pdf (https://ukcitizen2021.org/Case_Briefing_Document_and_lab_report_Ref_AUC_101_Report%20.pdf)
This report, ref AUC_101_Report, which was commissioned by EbMCsquared CiC and prepared and published by UNIT relates to initial findings and forms a strong case for continued further scientific investigation.
⚠️On the Clear Evidence of the Risks to Children from Smartphone and WiFi Radio Frequency Radiation [PDF]⚠️
https://bit.ly/3VKaOSY
MIRROR SOURCE, You are encouraged to follow/support/credit the original content creator, if you see fit:
⫸La Quinta Columna⫷
rumble.com/c/LaQuintaColumna | https://odysee.com/@laquintacolumnainternational:7 (https://rumble.com/c/LaQuintaColumna | https://odysee.com/@laquintacolumnainternational:7) 🎬
odysee.com/@laquintacolumnainternational:7/Conference-of-La-Quinta-Columna-The-game-is-over:f (https://odysee.com/@laquintacolumnainternational:7/Conference-of-La-Quinta-Columna-The-game-is-over:f) 🎬
🇪🇸Spanish voice - 🇬🇧🇺🇸 English subtitles
▪️Conference of La Quinta Columna, Seville, March 19, 2023.
The true origin of covid-19 and the Transhumanist objective of the operation.
True origin of what they call COVID-19.
Explanation of each of the causes of death in today's excess mortality.
Final purpose and TRANSHUMANIST objective.
to end: Farewell and closing.
▪️Official Telegram channels and website of La Quinta Columna:
🌐 Telegram:
t.me/laquintacolumna (https://t.me/laquintacolumna)
t.me/laquintacolumnainternational (https://t.me/laquintacolumnainternational)
t.me/miraalmicroscopio (https://t.me/miraalmicroscopio)
🌐 Website:
laquintacolumna.info (https://www.laquintacolumna.info)
🗳 Collaborate with La Quinta Columna:
laquintacolumna.info/colabora-con-la-quinta-columna (https://www.laquintacolumna.info/colabora-con-la-quinta-columna)
ExomatrixTV
1st May 2023, 20:29
Covid-19 "Vaccine" Sheds Graphene-like Substance That Causes Cellular Damage And Blood Clots In The Unvaccinated, Warns Doctor (https://www.depopulation.news/2023-04-18-vaccine-graphene-cellular-damage-blood-clots-unvaccinated.html)
Ravenlocke
28th May 2023, 15:15
https://twitter.com/Resistance20001/status/1662829177991573504?s=20
1662829177991573504
Ravenlocke
28th May 2023, 19:24
https://twitter.com/Resistance20001/status/1662887209358196736
1662887209358196736
onawah
28th May 2023, 21:13
EDTA Chelation to remove heavy metals
See:https://anamihalceamdphd.substack.com/p/there-is-hope-edta-chelation-works
Posted here: https://projectavalon.net/forum4/showthread.php?117086-Vaxx-Shedding-how-would-you-know-you-are-affected-by-it&p=1559595&viewfull=1#post1559595
Delight
17th January 2024, 02:29
I feel very convinced now that we cannot see what is happening with terraforming, poisoning and radiation and the stated "post human world" sought and believe this is HUMAN greed. It just makes NO SENSE that humans would plan and execute this murder of Life itself?
'David Icke was right about "Covid", the jab, the Cloud, and manipulation by a non-human force' - by the team that identified graphene in the fake vaccine
Jan 16, 2024
65a6c2f2a2bca6fd622615e7
TargeT
17th January 2024, 05:09
Thread participants, answer me this: what is Graphene made of, and why is it fascinating (https://en.wikipedia.org/wiki/Graphene)?
Delight
22nd January 2024, 22:07
1745622434315927879
ExomatrixTV
4th February 2024, 14:34
FDA confirms Graphene Oxide is in the Covid-19 Vaccines (https://principia-scientific.com/fda-confirms-graphene-oxide-is-in-the-covid-19-vaccines/)
The Discovery Of Graphene And Nano-technology In Covid Vaccines - Dr. Pablo Campra:
We present here our research on the presence of graphene in covid vaccines. We have carried out a random screening of graphene-like nanoparticles visible at the optical microscopy in seven random samples of vials from four different trademarks, coupling images with their spectral signatures of RAMAN vibration. By this technique, called micro-RAMAN, we have been able to determine the presence of graphene in some of these samples, after screening more than 110 objects selected for their graphene-like appearance under optical microscopy. Out of them, a group of 28 objects have been selected, due to the compatibility of both images and spectra with the presence of graphene derivatives, based on the correspondence of these signals with those obtained from standards and scientific literature. The identification of graphene oxide structures can be regarded as conclusive in 8 of them, due to the high spectral correlation with the standard. In the remaining 20 objects, images coupled with Raman signals show a very high level of compatibility with undetermined graphene structures, however different than the standard used here. This research remains open and is made available to scientific community for discussion. We make a call for independent researchers, with no conflict of interest or coaction from any institution to make wider counter-analysis of these products to achieve a more detailed knowledge of the composition and potential health risk of these experimental drugs, reminding that graphene materials have a potential toxicity on human beings and its presence has not been declared in any emergency use authorization. We leave a link to download this report at the end of this video.
researchgate.net/publication/355979001_DETECTION_OF_GRAPHENE_IN_COVID19_VACCINES (https://www.researchgate.net/publication/355979001_DETECTION_OF_GRAPHENE_IN_COVID19_VACCINES)
odysee.com/@SixthSense-Truth-Search-Labs:0/0-DETECTION-OF-GRAPHENE-IN-COVID19-VACCINES-campra-informe-tecnico-en:b (https://odysee.com/@SixthSense-Truth-Search-Labs:0/0-DETECTION-OF-GRAPHENE-IN-COVID19-VACCINES-campra-informe-tecnico-en:b)
v2b04de/?pub=ir01b
meat suit
7th March 2024, 16:20
https://vigilantnews.com/post/new-peer-reviewed-paper-highlights-dangers-of-graphene-nanomaterials/
Graphene nanomaterials have many routes and mechanisms of toxicity, which are explored in the article. Importantly, the article also explores how to degrade graphene oxide, which can be accomplished through several mechanisms.
This article empowers anyone looking to remove graphene contamination from biological systems, enabling the development of ecosystem bioremediation services and mechanisms for removing graphene nanomaterials from the human body if necessary. Other medical professionals may build off of this summary. It must be stressed that this is preliminary scientific work and not medical advice.
Potential agents for the degradation of graphene nanomaterials include humic acid, Shilajit, kaolin, and bentonite nanoclay.
Our bodies also have the capacity to degrade graphene oxide via the enzyme eosinophil peroxidase, which is produced by eosinophils, a type of white blood cell, in the presence of low concentrations of hydrogen peroxide and sodium bromide. Myeloperoxidase (MPO) is produced by neutrophils in the presence of low concentrations of hydrogen peroxide, and can also degrade graphene oxide. Horseradish peroxidase and nitric oxide can also degrade graphene oxide.
The focus of this work remains solutions-focused—at the World Council for Health, we say, “Be a warrior, not a worrier”. This article contributes to those concerned about the health impacts of graphene nanomaterials and how to clean them up from our environment and bodies. We are grateful for your support of the World Council for Health, which allows us to perform original research.
Copyright 2024 World Council for Health
meat suit
20th May 2024, 12:41
https://t.me/AThinker_2005/1237
Graphene can be printed by laser onto/ maybe into things...
I cant quite yet comprehend this rabbit hole..
AThinker_2005/1237
Tintin
20th May 2024, 17:35
https://t.me/AThinker_2005/1237
Graphene can be printed by laser onto/ maybe into things...
I cant quite yet comprehend this rabbit hole..
AThinker_2005/1237
Video now embedded :muscle:
https://avalonlibrary.net/Tintin/Various_%28of_interest%29/Rice_University_Video_From_2018_Shows_How_Graphene_Is_Embedded_In_Products.MP4
Arcturian108
20th May 2024, 17:53
What I am noticing in this video is the use of the owl symbol, which reminds me of its satanic use. Trying to find that connection online, however, was nonexistent, which surprised me.
Powered by vBulletin™ Version 4.1.1 Copyright © 2026 vBulletin Solutions, Inc. All rights reserved.