+ Reply to Thread
Page 5 of 11 FirstFirst 1 5 11 LastLast
Results 81 to 100 of 213

Thread: Graphene in the 'vaccines'

  1. Link to Post #81
    Avalon Member
    Join Date
    3rd July 2018
    Posts
    4,401
    Thanks
    40,623
    Thanked 33,812 times in 4,381 posts

    Default Re: Graphene in the 'vaccines'

    DEADLY SHOTS! Former Pfizer Employee Confirms Poison in COVID 'Vaccine'

    Stew Peters Show
    Published July 28, 2021


    Source: https://www.rumble.com/video/vhu7kx


    Rumble — EXCLUSIVE! Karen Kingston, a former Pfizer employee and current analyst for the pharmaceutical and medical device industries, came forward with indisputable documentation that should be shared with the ENTIRE WORLD!

    The inoculation being referred to as 'COVID Vaccines' is a poisonous death sentence, and nobody should subject themselves to the shots.

  2. The Following 18 Users Say Thank You to Gwin Ru For This Post:

    Alecs (30th July 2021), Apulu (29th July 2021), Bill Ryan (29th July 2021), bluestflame (29th July 2021), BushPilot (2nd August 2021), Constance (29th July 2021), Ewan (29th July 2021), fifi (3rd August 2021), Harmony (29th July 2021), haroldsails (30th July 2021), I am B (29th July 2021), Jambo (29th July 2021), janette (31st July 2021), Pam (29th July 2021), pueblo (2nd August 2021), Reinhard (29th July 2021), Victoria (4th August 2021), wondering (29th July 2021)

  3. Link to Post #82
    UK Avalon Founder Bill Ryan's Avatar
    Join Date
    7th February 2010
    Location
    Ecuador
    Posts
    34,425
    Thanks
    211,552
    Thanked 459,735 times in 32,946 posts

    Default Re: Graphene in the 'vaccines'

    Quote Posted by Gwin Ru (here)
    DEADLY SHOTS! Former Pfizer Employee Confirms Poison in COVID 'Vaccine'

    Stew Peters Show
    Published July 28, 2021


    Source: https://www.rumble.com/video/vhu7kx


    Rumble — EXCLUSIVE! Karen Kingston, a former Pfizer employee and current analyst for the pharmaceutical and medical device industries, came forward with indisputable documentation that should be shared with the ENTIRE WORLD!

    The inoculation being referred to as 'COVID Vaccines' is a poisonous death sentence, and nobody should subject themselves to the shots.
    ~~~

    Here's the patent which features the application of graphene oxide. (Not the Moderna patent, but the original Chinese one.) The text below is a formal English translation. The formatting was good but not perfect, so I improved it just a tiny bit in one or two places.

    https://patents.google.com/patent/CN112220919A/en

    ~~~

    Nano coronavirus recombinant vaccine taking graphene oxide as carrier

    Abstract

    The invention belongs to the field of nano materials and biomedicine, and relates to a vaccine, in particular to development of 2019-nCoV coronavirus nuclear recombinant nano vaccine. The invention also comprises a preparation method of the vaccine and application of the vaccine in animal experiments. The new corona vaccine contains graphene oxide, carnosine, CpG and new corona virus RBD; binding carnosine, CpG and neocoronavirus RBD on the backbone of graphene oxide; the CpG coding sequence is shown as SEQ ID NO 1; the novel coronavirus RBD refers to a novel coronavirus protein receptor binding region which can generate a high-titer specific antibody aiming at the RBD in a mouse body, and provides a strong support for prevention and treatment of the novel coronavirus.

    Classifications

    A61K39/12 Viral antigens
    A61K39/385 Haptens or antigens, bound to carriers
    A61K39/39 Medicinal preparations containing antigens or antibodies characterised by the immunostimulating additives, e.g. chemical adjuvants
    A61P31/14 Antivirals for RNA viruses
    C07K14/005 Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from viruses
    C07K17/14 Peptides being immobilised on, or in, an inorganic carrier
    A61K2039/55561 CpG containing adjuvants; Oligonucleotide containing adjuvants
    A61K2039/60 Medicinal preparations containing antigens or antibodies characteristics by the carrier linked to the antigen
    A61K2039/627 Medicinal preparations containing antigens or antibodies characterised by the link between antigen and carrier characterised by the linker
    C12N2770/20022 New viral proteins or individual genes, new structural or functional aspects of known viral proteins or genes
    C12N2770/20034 Use of virus or viral component as vaccine, e.g. live-attenuated or inactivated virus, VLP, viral protein

    Description

    Nano coronavirus recombinant vaccine taking graphene oxide as carrier

    Technical Field

    The invention belongs to the field of nano materials and biomedicine, and relates to development of a vaccine development platform. In particular to the development of 2019-nCoV coronavirus nuclear recombinant nano-vaccine. The invention also includes the use of the vaccine in animal testing.

    Technical Field

    The vaccine is an ultimate weapon for eliminating major infectious diseases, has the advantages of lowest cost and more advantages of prior enemy than other therapies, undoubtedly becomes hopeful to the public, the smallpox is eliminated by human beings through vaccination, the poliomyelitis cases are reduced by 99 percent, the infectious diseases such as diphtheria are rare, and the incidence rate of diseases such as measles, neonatal tetanus and the like is remarkably reduced. The effect of vaccines on human health is not excessive, and the birth of each new vaccine is a great victory for human beings to overcome an infectious disease! To date, no medical treatment has been able to have such an important, lasting and profound effect on human health as a vaccine; nor is any therapeutic available to eliminate a disease from the earth at the very least cost of a vaccine.

    After the occurrence of SARS-CoV-2 epidemic, different laboratories in China have completed the isolation of virus strains, and in order to make a big step forward in vaccine development, we believe that we will soon have a final weapon for the eradication of SARS-CoV-2, however, until now there is no approved vaccine or drug for the treatment of CoV infection, and there is a great need to develop an effective drug for the treatment or prevention of coronavirus infection and outbreak.

    According to the research of coronavirus vaccines such as SARS and MERS, the main target point of the existing coronavirus vaccine is the S protein of coronavirus. Vaccines need to induce not only humoral and cellular immune responses, but also mucosal immune responses, and with the aid of adjuvants to induce balanced Th1 and Th2 pathways to produce truly effective vaccines. At present, the research of more SARS and MERS vaccines mainly focuses on viral vector vaccines and subunit vaccines, and a large number of researches show that the difficulty of SARS and MERS lies in that long-term memory B cells cannot be stimulated to generate, the long-term memory cells in the healed SARS and MERS patients can only last for 2-3 years, immunological memory cannot be generated, and the vaccine development failure is caused, and only 6 potential coronavirus vaccines enter the clinical research stage at present, but no 1 effective vaccine is approved to be marketed.

    Disclosure of Invention

    The invention aims to provide a coronavirus recombinant vaccine.

    Another purpose of the invention is to provide a preparation method of the virus recombinant vaccine.

    It is still another object of the present invention to provide the use of the recombinant vaccine of the virus.

    In view of various problems of the conventional vaccines at present, how to change the problems of the existing vaccines and enhance immune response is a problem which is always considered, in order to improve the immunocompetence of the immunogen and enhance the immune response capability of the body, the most basic method is to mix the immunogen with an adjuvant, and the immune adjuvant is a promoter capable of enhancing the immune response of the body to the immunogen. CpG Oligodeoxynucleotide (ODN) is a very promising adjuvant discovered in recent years. CpG ODN has been shown to have better adjuvant activity in vivo, in vitro and clinical studies in animals, and the best studies are CpG7909 and CpG 1018. 11/9.2017, the hepatitis B vaccine approved by Dynavax Technologies of the United states of America FDA and using CpG1018 as an adjuvant is on the market, is the first approved CpG ODN adjuvant vaccine in the world and is used for preventing HBV infection of adults 18 years old and older, and a plurality of different types of CpG ODN are used as adjuvants in a plurality of clinical trials. CpG is combined with TLR9 to activate immature pDC cells and induce natural and adaptive immune response, but a single CpG structure has limited activation effect on immune cells and is easy to be rapidly hydrolyzed by exonuclease, so that the stability of the CpG in vivo is insufficient, and side effects are also caused; CpG Oligodeoxynucleotide (ODN) synthesized in the sequence can also enhance the stimulation effect, and after the CpG is coupled with other proteins such as antigen and the like, the CpG oligodeoxynucleotide is combined, so that the CpG oligodeoxynucleotide has a very obvious immune activation effect.

    Graphene is a two-dimensional carbon nanomaterial consisting of carbon atoms in sp hybridized orbitals in a hexagonal honeycomb lattice. The basic structural unit of the material is the most stable benzene six-membered ring in the organic material, and the material is the most ideal two-dimensional material at present. Graphene Oxide (GO) is a Graphene oxide derivative, and is a exfoliated product. Due to the characteristics of unique SP2 hybridization, a perfect two-dimensional structure and high reactivity of the edge, the treatment platform based on the hybrid structure can be used as an ideal load and grafting carrier in design and development, and plays an important role in aspects of nano-drug delivery systems, biological detection, tumor treatment, cell imaging and the like.

    The present invention has been completed based on the above-mentioned studies.

    The invention discloses a brand-new vaccine development method based on a graphene oxide material serving as a framework for loading CpG molecules and recombinant proteins. Based on the technical platform, a new nano new crown vaccine is prepared by combining the recombinant protein of the RBD region of the Spike protein of the SAR-CoV-2. The prepared nano new corona vaccine has stronger immunogenicity in mouse experiments and can generate high-titer antibodies.

    In one aspect, the invention provides a coronavirus vaccine comprising graphene oxide, carnosine, CpG, and RBD. In a preferred embodiment of the invention, the vaccine is named GO-Car-carnosine-CpG-RBD vaccine.

    Graphene Oxide (GO) is an oxide of graphene, and after oxidation, oxygen-containing functional groups on the graphene oxide are increased, so that the graphene oxide is more active than graphene. For example, hydroxyl groups and epoxy groups are randomly distributed on a graphene oxide monolith, while carboxyl groups and carbonyl groups are introduced at the edge of the monolith. Common commercial products of graphene oxide are in the form of powder, flakes and solutions, and are brown-yellow in color.

    Carnosine, known by the scientific name β-alanyl-L-histidine, is a crystalline solid composed of a dipeptide consisting of two amino acids, β-alanine and L-histidine. Carnosine has strong antioxidant ability, and can scavenge Reactive Oxygen Species (ROS) and alpha-beta unsaturated aldehydes, which are formed by over-oxidation of fatty acids in cell membranes during oxidative stress.

    CpG motifs have the effect of activating the body's immune system and can be used as adjuvants. Preferably, the CpG coding sequence is shown as SEQ ID NO 1.

    RBD (spike receptor binding domain), specifically a coronavirus protein (S protein) Receptor Binding Domain (RBD) in the present invention. For example, the RBD protein can be selected as follows:

    PNITNLCPFGEVFNATRFASVYAWNRKRISNCVADYSVLYNSASFSTFKCYGVSPTKLNDLCFTNVYADSFVIRGDEVRQIAPGQTGKIADYNYKLPDDF TGCVIAWNSNNLDSKVGGNYNYLYRLFRKSNLKPFERDISTEIYQAGSTPCNGVEGFNCYFPLQSYGFQPTNGVGYQPYRVVVLSFELLHAP(SEQ ID NO 2)。
    the coronavirus vaccine disclosed by the invention is obtained by combining carnosine, CpG and a novel coronavirus RBD on activated graphene oxide.

    The dosage of GO in the coronavirus vaccine provided by the invention is used as a framework base, the dosage is usually excessive, and the dosage of carnosine can be about twice of that of GO. CpG and new coronavirus RBD are used as biological macromolecules, and the dosage of the CpG and the new coronavirus RBD is less, and is usually one ten thousandth of that of GO in mass ratio. And RBD is used in an amount more than 2 times that of CpG, such as CpG: RBD = 1: 2-10, preferably, the dosage of RBD is 3-6 times of that of CpG.

    In another aspect, the present invention provides a method for preparing the coronavirus vaccine, the method comprising the steps of:
    • obtaining CpG, RBD recombinant protein and carnosine;
    • adding freeze-dried GO powder into a phosphate buffer solution, and carrying out ultrasonic treatment;
    • adding EDC and NHS to activate GO solution, removing excess EDC/sulfo-NHS in the reaction solution through ultrafiltration, and adjusting the pH of the reaction solution to be neutral;
    • adding carnosine, CpG, and RBD recombinant proteins to the reaction solution, incubating with activated GO;
    Excess unconjugated protein was removed from the reaction solution and sterilized for use.

    Preferably, the duration of the ultrasound is 2 to 3 hours. The ultrasonic conditions were 200W, 40 kHz.

    Preferably, the phosphate buffer has a neutral pH, e.g., 6.8 to 7.6, more preferably 7.0 to 7.4, or 7.2.

    Preferably, the method of removing excess EDC/sulfo-NHS or unconjugated protein is ultrafiltration.

    In a preferred embodiment of the present invention, the ratio of graphene oxide, carnosine, CpG, and RBD is: 26 mg: 40 mg: 1.2. mu.g: (3-6) μg.

    Preferably, the reaction temperature is 20-28 ℃. For example, room temperature is used.

    In a preferred embodiment of the present invention, the GO-Car-carnosine-CpG-RBD vaccine is prepared by the following method: GO was coupled to carnosine using a modification of the EDC-NHS reaction, 26mg of GO lyophilized powder was added to 5.20 mL of phosphate buffer (PBS, pH = 7.4) and sonicated (200W, 40 kHz) at 25 ℃ for 3 h. The GO solution was activated by the addition of 6.82 mg EDC (N1- ((ethylimino) methyl-ene) -N3, N3-dimethyl propane-1,3-diamine, Chinese: 1- (3-dimethylaminopropyl) -3-ethylcarbodiimide) and 7.73 mg NHS (N-N-hydroxysuccinimide) at 25 ℃. Excess EDC/sulfo-NHS was removed from the reaction solution by ultrafiltration and the pH of the solution was then adjusted to 7.4. Then, 40mg of carnosine, 1.2μg CpG, and various concentrations of RBD recombinant protein were added to the solution and reacted with activated GO at 25 ℃ for 2 h. Subsequently, excess unconjugated protein was removed from the reaction solution by ultrafiltration. The prepared product is marked as GO-Car-carnosine-CpG-RBD vaccine. Finally, GO-Car-carnosine-CpG-RBD vaccine solution was contacted with sterile filter (0.22 um) and stored in sterile containers at 4 ℃ for subsequent experiments.

    The invention establishes a nano recombinant protein vaccine preparation technical platform capable of quickly exciting the human immune system, and can quickly produce a large amount of preventive vaccines after infectious viruses are confirmed. The technical platform fully utilizes the characteristic that the surface of graphene oxide is provided with COOH, hydroxyl and other groups, and utilizes the interaction between pi-pi bonds to assemble the screened RBD recombinant protein, CpG molecules and carnosine together to prepare the nano recombinant protein vaccine based on the graphene oxide as the framework. The vaccine can stimulate an organism to generate a high-titer RBD neutralizing antibody aiming at SAR-CoV-2, and lays a technical foundation for preventing and treating coronavirus infection and future large outbreaks of similar epidemics.

    In another aspect, the invention provides an application of the GO-Car-carnosine-CpG-RBD vaccine, namely an application of the GO-Car-carnosine-CpG-RBD vaccine in preparation of a medicine for preventing a new coronavirus.

    Preferably, the application of the composition can improve the immunity of organisms to the new coronavirus.

    Preferably, the GO-Car-carnosine-CpG-RBD vaccine can generate specific antibodies aiming at RBD, and the specific antibody titer is high. In the embodiment of the invention, the nano neocorona vaccine realizes stronger immunogenicity in a mouse test and can generate high-titer antibodies.

    The invention has the beneficial effects that:

    A brand-new vaccine technical platform is developed for a framework loaded CpG molecule and recombinant protein based on a graphene oxide material and combined with the recombinant protein of the RBD region of the Spike protein of SAR-CoV-2 to prepare a novel nano coronavirus vaccine, a high-titer specific antibody aiming at the RBD can be generated in a mouse body, and a strong support is provided for prevention and treatment of novel coronavirus.

    Drawings


    In order to more clearly illustrate the technical solutions in the embodiments of the present application, the drawings needed to be used in the embodiments will be briefly described below, and it is obvious that the drawings in the following description are only some embodiments of the present application, and it is obvious for those skilled in the art to obtain other drawings without creative efforts.

    FIG. 1 is a schematic diagram and time schematic representation of GO-Car-carnosine-CpG-RBD vaccine mouse immunization;

    FIG. 2 shows the change of specific RBD antibody in serum 28 days after the mice were immunized and the change of cytokine production by spleen cells 42 days after the mice were immunized.

    Detailed Description

    The technical solutions in the embodiments of the present application will be described clearly and completely below, and it should be understood that the described embodiments are only a part of the embodiments of the present application, and not all embodiments. All other embodiments, which can be derived by a person skilled in the art from the embodiments given herein without making any creative effort, shall fall within the protection scope of the present application. Methods and techniques not specifically described may be performed using techniques conventionally known in the art. For example, refer to molecular cloning handbook of cold spring harbor.

    Example 1

    Preparation process of Graphene Oxide (GO) -carnosine-CpG-RBD recombinant protein vaccine preparation

    Selecting a TLR9 receptor nucleic acid sequence CpG ODN M362 which has cross reaction to both human and mouse, wherein the specific sequence is as follows: 5 '-TCGTCGTCGTTC: GAACGACGTTGAT-3' (25 mer, SEQ ID NO 1), coupling GO with carnosine using a modification of the EDC-NHS reaction, 26mg of a lyophilized powder of GO was added to 5.20 mL of phosphate buffer (PBS, pH = 7.4) and sonicated (200W, 40 kHz) at 25 ℃ for 3 h. The GO solution was activated by the addition of 6.82 mg EDC (N1- ((ethylimino) methyl-ene) -N3, N3-dimethyl propane-1,3-diamine, Chinese: 1- (3-dimethylaminopropyl) -3-ethylcarbodiimide) and 7.73 mg NHS (N-N-hydroxysuccinimide) at 25 ℃. Excess EDC/sulfo-NHS was removed from the reaction solution by ultrafiltration and the pH of the solution was then adjusted to 7.4. Then, 40mg of carnosine, 1.2μg CpG, and various concentrations of RBD recombinant protein were added to the solution and reacted with activated GO at 25 ℃ for 2 h. Subsequently, excess unconjugated protein was removed from the reaction solution by ultrafiltration. The prepared product is marked as GO-Car-carnosine-CpG-RBD vaccine. Finally, GO-Car-carnosine-CpG-RBD vaccine solution was contacted with sterile filter (0.22 um) and stored in sterile containers at 4 ℃ for subsequent experiments.

    Example 2

    Test of Graphene Oxide (GO) -carnosine-CpG-RBD recombinant protein vaccine immunized mice

    6-week-old female BALB/c mice were immunized by subcutaneous injection at 0, 14, and 28 days, respectively, for 28 days and 42 days according to the schedule shown in FIG. 1, blood was collected by drawing blood at , and serum was separated and tested for specific antibodies against RBD. Mice were sacrificed at 42 days, splenocytes isolated, and tested for specific T cell immune responses and cytokine secretion.

    Grouping and dose determination of immunized mice:

    1. (graphene oxide + carnosine) + 1.2μg cpG +3μg RBD
    2. (graphene oxide + carnosine) + 1.2μg cpG +6μg RBD
    3. Aluminum hydroxide +6μg RBD (1: 1)
    4. 6μg RBD
    5. Liposome (lipo) +6μg RBD group

    Mouse strains: BALB/c mic (n = 6).

    The schedule for immunization of mice with the GO-Car-carnosine-CpG-RBD vaccine is: blood was collected and first immunized as starting point for immunization of mice. And (5) collecting blood for the second time on the 7 th day, and inspecting a new corona virus adding system to master the principle. Collecting blood for the third time on day 14, and enhancing immunity. Collecting blood for the fourth time on day 28, enhancing immunity, detecting antibody in serum, and if positive, preparing to collect spleen cells. The fifth blood collection on day 42, after which the blood was sacrificed and splenocytes were isolated and subjected to cytokine experiments.

    The test results show that 3μg and 6μg groups of the GO-Car-carnosine-CpG-RBD vaccine generate high-titer specific antibodies for RBD after mice are immunized, and the GO-Car-carnosine-CpG-RBD vaccine is significantly different from the traditional adjuvant group, the RBD group and the liposome group (figure 2). Further analyzing the specific immune response of the T cells separated from the spleen, the result shows that the GO-Car-carnosine-CpG-RBD vaccine can stimulate the organism to generate specific IFN-gamma cytokines, improve the immunity of the organism and resist the epidemic situation of new coronavirus.

    The above description is only for the specific embodiments of the present application, but the scope of the present application is not limited thereto, and any changes or substitutions that can be easily conceived by those skilled in the art within the technical scope of the present disclosure should be covered within the scope of the present application. Therefore, the protection scope of the present application shall be subject to the protection scope of the claims.


    ~~~~

    The original is here, in Chinese, this document containing the illustrations.

    The application was filed by Shanghai National Engineering Research Center for Nanotechnology Co Ltd on 27 September, 2020.

    https://patentimages.storage.googlea...112220919A.pdf

    Last edited by Bill Ryan; 29th July 2021 at 00:49.

  4. The Following 24 Users Say Thank You to Bill Ryan For This Post:

    Alecs (30th July 2021), Arcturian108 (29th July 2021), bluestflame (29th July 2021), BushPilot (2nd August 2021), Constance (29th July 2021), Eva2 (3rd August 2021), Ewan (29th July 2021), fifi (3rd August 2021), gord (29th July 2021), Gwin Ru (29th July 2021), Harmony (29th July 2021), haroldsails (30th July 2021), I am B (29th July 2021), Icare (2nd August 2021), Jambo (29th July 2021), janette (31st July 2021), onevoice (29th July 2021), Pam (29th July 2021), pueblo (2nd August 2021), Reinhard (29th July 2021), Satori (29th July 2021), Sue (Ayt) (29th July 2021), thepainterdoug (29th July 2021), Yoda (29th July 2021)

  5. Link to Post #83
    Avalon Member
    Join Date
    3rd July 2018
    Posts
    4,401
    Thanks
    40,623
    Thanked 33,812 times in 4,381 posts

    Default Re: Graphene in the 'vaccines'

    ...

    ... the reasons why defiant heads of states died and why no amount of logic or rationality can even put a dent in the resolve of subservient governments to mandate "vaccines":

    Pfizer has hit the goldmine during Covid Crisis, alleged leaked contract shows appalling terms and conditions

    Leaked confidential agreement allegedly between Pfizer and Albania reveals how Pfizer is ripping off countries

    by Abhyoday Sisodia
    July 28, 2021
    in Americas
    Reading Time: 3 mins read



    If someone wants to look at how low these pharma companies can stoop to maximise their profits even when the whole of humanity is facing a global pandemic, look no further than Pfizer. While the company tried to hide its manufacturing and supply agreements behind confidentiality, the alleged agreement with the Albanian government has seemingly spilled the beans. It elaborates on the crony capitalist, profit maximisation and neo-colonial approach of the pharma company. After this allegation, Pfizer has a lot to answer for.

    Pfizer has been extremely aggressive in trying to protect the details of its international COVID19 vaccine agreements. However, the latest leak claimed by Twitter user Ehden, who is an information security and privacy professional based in the United Kingdom, has revealed startling details allegedly about the Pfizer vaccine agreement with the Albanian government. It is in some sort similar to the agreements Western powers would have made with their colonies, these are the modern formulation of unequal treaties.

    The alleged leaked confidential agreement is with the government of Albania and it not only covers the manufacturing of vaccines for COVID19 and its mutations, but also for “any device, technology, or product used in the administration of or to enhance the use or effect of, such vaccine”. So here vaccine is used as an umbrella term for everything related to vaccines under the sun. The alleged agreement does not allow signatory countries to escape their contract, which states that even if a drug will be found to treat COVID19 the contract cannot be voided. This is the reason why many governments were not enthusiastic about employing Ivermectin, given it would have only added to the cost.

    So this is one of the many examples in the alleged agreement which raises suspicion about Pfizer being more concerned about maximising profit rather than using its resources for the betterment of the people. The alleged agreement goes on to say, while Pfizer shall not be liable to the failure to deliver doses in accordance with est delivery dates, it will have the power to decide on necessary adjustments to the number of contracted doses and delivery schedule due to the purchaser based on principles to be determined by Pfizer and the purchaser shall be deemed to agree to any revision, decided by Pfizer.

    The alleged document stated that the purchaser acknowledges the long-term effects and efficacy of the vaccine are not currently known and that there may be adverse effects of the vaccine that are not currently known. So even if the vaccine leads to some problems, the purchaser cannot sue the company, what a noble act!

    It further states that the purchaser hereby agrees to indemnify, defend and hold harmless Pfizer, BioNTech (and) their affiliates from and against any and all suits, claims, actions, demands, losses, damages, liabilities, settlements, penalties, fines, costs and expenses. So the purchaser state has been made responsible to save this big pharma company, against the complaints of its own citizens. Through the allegedly leaked confidential agreement, the Twitter user claims that Pfizer shall also have the right to assume control of such defence and the purchaser shall pay all losses, including, without limitation, the reasonable attorneys’ fees and other expenses incurred.

    To further raise questions about profit maximisation and hollow ethics of the company, the alleged agreement revealed that the vaccines were sold for $12 to Albania, while it was sold at the rate of $19 per shot in the US and Israel.

    Related:

  6. The Following 21 Users Say Thank You to Gwin Ru For This Post:

    Alecs (30th July 2021), Apulu (29th July 2021), Bill Ryan (29th July 2021), bluestflame (29th July 2021), BushPilot (2nd August 2021), Eva2 (3rd August 2021), Ewan (29th July 2021), gord (29th July 2021), Harmony (29th July 2021), haroldsails (30th July 2021), Icare (2nd August 2021), Jambo (29th July 2021), janette (31st July 2021), mountain_jim (29th July 2021), Pam (29th July 2021), pueblo (2nd August 2021), Reinhard (29th July 2021), Satori (29th July 2021), Sue (Ayt) (29th July 2021), Tintin (29th July 2021), Victoria (4th August 2021)

  7. Link to Post #84
    Avalon Member
    Join Date
    26th May 2010
    Location
    Albuquerque, NM, USA
    Age
    73
    Posts
    2,456
    Thanks
    11,402
    Thanked 22,119 times in 2,425 posts

    Default Re: Graphene in the 'vaccines'

    Holy f***ing s**t. This is so off the charts. It’s beyond evil. This is an entirely new dimension of evil.

    Edit: I’m referring to post #82, the Stew Peters video and the additional information provided by Bill.
    Last edited by Satori; 29th July 2021 at 01:01.

  8. The Following 23 Users Say Thank You to Satori For This Post:

    Alecs (30th July 2021), Arcturian108 (29th July 2021), Bill Ryan (29th July 2021), bluestflame (29th July 2021), BushPilot (2nd August 2021), Eva2 (3rd August 2021), Ewan (29th July 2021), gord (29th July 2021), Gwin Ru (29th July 2021), Harmony (29th July 2021), haroldsails (30th July 2021), Jambo (29th July 2021), janette (31st July 2021), mountain_jim (29th July 2021), onawah (1st August 2021), onevoice (29th July 2021), Pam (29th July 2021), pueblo (2nd August 2021), Reinhard (29th July 2021), Sue (Ayt) (29th July 2021), thepainterdoug (29th July 2021), Tintin (29th July 2021), Victoria (4th August 2021)

  9. Link to Post #85
    United States Moderator Sue (Ayt)'s Avatar
    Join Date
    23rd December 2016
    Language
    English
    Posts
    2,596
    Thanks
    28,786
    Thanked 20,909 times in 2,594 posts

    Default Re: Graphene in the 'vaccines'

    I found several older links that prove that Karen Kingston (from Stew Peters video, posts 81 and 82 above) is who she claims to be.
    This video is a MUST WATCH, and truly terrifying.

    Karen Kingston - who is she? Some older links:

    https://www.tsnn.com/news/healthcare...-board-members

    https://www.neovirucide.com/scientificboard

    https://www.nmbtherapeutics.com/scientificboard

    http://varitage.com/founder/

    https://seekingalpha.com/article/143...ld-be-watching

    https://marketcaliber.com/2013/05/15...pdate-5152013/
    Last edited by Sue (Ayt); 29th July 2021 at 06:39.
    "We're all bozos on this bus"

  10. The Following 23 Users Say Thank You to Sue (Ayt) For This Post:

    Alecs (31st July 2021), Apulu (29th July 2021), Bill Ryan (29th July 2021), Billy Vasiliadis (29th July 2021), bluestflame (29th July 2021), BushPilot (2nd August 2021), Delight (29th July 2021), Ewan (29th July 2021), gord (29th July 2021), Gwin Ru (29th July 2021), Harmony (29th July 2021), haroldsails (30th July 2021), Icare (2nd August 2021), janette (31st July 2021), mountain_jim (29th July 2021), onawah (31st July 2021), onevoice (29th July 2021), Pam (29th July 2021), pueblo (2nd August 2021), Reinhard (29th July 2021), thepainterdoug (29th July 2021), TravelerJim (29th July 2021), Victoria (4th August 2021)

  11. Link to Post #86
    Scotland Avalon Member Ewan's Avatar
    Join Date
    24th February 2015
    Location
    Ireland
    Age
    62
    Posts
    2,446
    Thanks
    52,992
    Thanked 19,069 times in 2,400 posts

    Default Re: Graphene in the 'vaccines'

    Wow, wow and wow!

    Best I can come up with after a sixteen hour day and needing to sleep.

    I can only pray that a large percentage of vaccinations have been placebo, because, quite frankly, it really looks like the rest are screwed.

    Edit to add: Hope Stew and Karen don't have a strange accident in the near future.
    Last edited by Ewan; 29th July 2021 at 19:54.

  12. The Following 13 Users Say Thank You to Ewan For This Post:

    Alecs (31st July 2021), Bill Ryan (30th July 2021), bluestflame (30th July 2021), BushPilot (2nd August 2021), gord (30th July 2021), Gwin Ru (29th July 2021), Harmony (30th July 2021), haroldsails (30th July 2021), Icare (2nd August 2021), janette (31st July 2021), onawah (31st July 2021), Pam (1st August 2021), pueblo (2nd August 2021)

  13. Link to Post #87
    Avalon Retired Member
    Join Date
    26th January 2011
    Language
    English
    Posts
    3,453
    Thanks
    20,718
    Thanked 25,438 times in 3,321 posts

    Default Re: Graphene in the 'vaccines'


    Synthetic and living micropropellers stir up nanoparticles

  14. The Following 13 Users Say Thank You to Constance For This Post:

    Alecs (31st July 2021), Bill Ryan (30th July 2021), bluestflame (30th July 2021), Ewan (31st July 2021), Gwin Ru (29th July 2021), Harmony (30th July 2021), haroldsails (30th July 2021), Icare (2nd August 2021), janette (31st July 2021), onawah (31st July 2021), Pam (1st August 2021), Sue (Ayt) (29th July 2021), Victoria (4th August 2021)

  15. Link to Post #88
    Avalon Member
    Join Date
    3rd July 2018
    Posts
    4,401
    Thanks
    40,623
    Thanked 33,812 times in 4,381 posts

    Default Re: Graphene in the 'vaccines'

    Quote Posted by Gwin Ru (here)
    ...

    ... the reasons why defiant heads of states died and why no amount of logic or rationality can even put a dent in the resolve of subservient governments to mandate "vaccines":

    Pfizer has hit the goldmine during Covid Crisis, alleged leaked contract shows appalling terms and conditions

    [...]
    Pfizer Contracts Exposed
    16 hours ago


    Source: https://www.rumble.com/video/vhuyrj


    Cybersecurity Expert Ehden Biber has legally obtained copies of the Pfizer contracts with Albania, Brazil, Israel and the EU.

    He discovered the first one on an Albanian website, where it was published on January 2021. Its veracity was confirmed when he was able to see Brazil’s Pfizer contract, which is virtually identical on that country’s health ministry website, with a signature that was verified by DocuSign. He has since seen virtually same contract with the EU and heard the details of Israel’s Pfizer contract.

    The contract, which exposes Pfizer to zero liability for anything and places the liability for everything on the government, which is called the “Purchaser” in the contract.

    The deal is a criminal shakedown of epic proportions, the likes of which it is hard to even fathom. Why would anybody sign it?

    Reading the contract’s language sheds some light on the inexplicable behavior of the government authorities of the world and on the true nature of this whole COVID operation.

    It also may shed light on the untimely deaths of two African presidents and the Haitian president, who all very understandably refused to sign this contract!

    In his blog, Biber wrote, “If you were wondering why #Ivermectin was suppressed, well, it is because the agreement that countries had with Pfizer does not allow them to escape their contract, which states that even if a drug will be found to treat COVID19, the contract cannot be voided.”

    And here’s a shocking clause about supplying the product:
    “Pfizer shall have no liability for any failure to deliver doses in accordance with any estimated delivery dates… nor shall any such failure give Purchaser any right to cancel orders for any quantities of Product.

    “Pfizer shall decide on necessary adjustments to the number of Contracted Doses and Delivery Schedule due to the Purchaser … based on principles to be determined by Pfizer … Purchaser shall be deemed to agree to any revision.”
    So Pfizer can breach its own contract but their hitmen will kill you if you refuse to sign it!

    You can really see how this Globalist entity that is Pfizer hates nation states and will not recognize their laws but it acts like a “government that dictates to other governments around the world,” as Biber says. If we look around at the complete lawlessness and the meltdown of once-solid institutions all over the world, you can see that Big Pharma is being used like a massive battering ram against the national laws and national sovereignty of all nations.

    The contract forces the “Purchaser”, which is how they refer to the nation that is contracting with them to defend Pfizer’s interests and not those of the citizens they’re supposed to be representing and defending – and whose taxpayer money they’re using to pay Pfizer these billions of dollars.

    As Biber tweeted, Israel has turned into a pharmaceutical #BananaRepublic, where the priorities of a multinational supercedes the priorities of its citizens.

    Not only is Pfizer held completely harmless from all claims, the “Purchaser”, ie, the national government is responsible for Pfizer’s legal defense against any and all claims!

    However, “Pfizer shall have the right to assume control of such defense… and Purchaser shall pay all Losses, including, without limitation, the reasonable attorneys’ fees and other expenses incurred.” Pfizer makes sure the country will pay for everything.

    I really don’t get why governments across the world have signed this. What’s in it for them? Did they sign this voluntarily? It really seems like a colossal shakedown and a complete abdication on the part of these governments to protect their people. It’s malfeasance on a scale that beggars belief.

    THE ONLY WAY to get a product recall on these shots is if you can prove fault in Current Good Manufacturing Practice (CGMP), which is regulated by the FDA.

    However, CGMP will tell you NOTHING about mRNA, because we don’t have CGMP for an mRNA vaccine, so you cannot prove CGMP malpractice.


    Contributed by Alexandra Bruce

    Contact


  16. The Following 19 Users Say Thank You to Gwin Ru For This Post:

    Alecs (31st July 2021), avid (30th July 2021), Bill Ryan (30th July 2021), bluestflame (30th July 2021), BushPilot (2nd August 2021), Ewan (31st July 2021), fifi (3rd August 2021), Harmony (30th July 2021), janette (31st July 2021), meat suit (30th July 2021), mountain_jim (30th July 2021), Pam (1st August 2021), Peace in Oz (30th July 2021), pueblo (2nd August 2021), Reinhard (31st July 2021), Sue (Ayt) (30th July 2021), syrwong (4th August 2021), thepainterdoug (30th July 2021), wondering (31st July 2021)

  17. Link to Post #89
    Avalon Member
    Join Date
    3rd July 2018
    Posts
    4,401
    Thanks
    40,623
    Thanked 33,812 times in 4,381 posts

    Default Re: Graphene in the 'vaccines'

    Black Junk Surgically Removed From Injection Site With Magnet & Scalpel 03:24
    First published at 14:31 UTC on July 29th, 2021.

    Tim Truth
    Tim Truth
    Join our leading researchers on https://GroupDiscover.com to find the best videos from across the censorship-resistant internet platforms like Odysee, Rumble, LBRY, Bitchute & Brighteon.

  18. The Following 11 Users Say Thank You to Gwin Ru For This Post:

    Bill Ryan (30th July 2021), bluestflame (31st July 2021), Ewan (31st July 2021), fifi (3rd August 2021), Harmony (30th July 2021), janette (31st July 2021), mountain_jim (30th July 2021), Pam (1st August 2021), pueblo (30th July 2021), Reinhard (31st July 2021), wondering (31st July 2021)

  19. Link to Post #90
    United States Avalon Member thepainterdoug's Avatar
    Join Date
    27th November 2013
    Age
    70
    Posts
    3,228
    Thanks
    11,036
    Thanked 33,277 times in 3,171 posts

    Default Re: Graphene in the 'vaccines'

    perhaps a key relevant 2016 article from the Guardian UK that Dr Joseph Farrell recently took time to read to his audience.
    Could this be the connection to the magnetism, the Graphene Oxide and the mad push to get this into every arm ?

    https://www.theguardian.com/science/...-and-behaviour

  20. The Following 15 Users Say Thank You to thepainterdoug For This Post:

    Alecs (31st July 2021), Bill Ryan (31st July 2021), bluestflame (31st July 2021), Constance (2nd August 2021), Ewan (1st August 2021), fifi (3rd August 2021), Harmony (31st July 2021), janette (31st July 2021), mountain_jim (31st July 2021), onawah (31st July 2021), Pam (1st August 2021), pueblo (2nd August 2021), Reinhard (31st July 2021), Victoria (4th August 2021), wondering (31st July 2021)

  21. Link to Post #91
    United States Avalon Member onawah's Avatar
    Join Date
    28th March 2010
    Language
    English
    Posts
    22,269
    Thanks
    47,763
    Thanked 116,603 times in 20,701 posts

    Default Re: Graphene in the 'vaccines'

    Genetically engineered 'Magneto' protein remotely controls brain and behaviour
    (Here's that scary article ):


    "The toroidal magnetic chamber (Tokamak) of the Joint European Torus (JET) at the Culham Science Centre. Photograph: AFP/Getty Images
    “Badass” new method uses a magnetised protein to activate brain cells rapidly, reversibly, and non-invasively

    Mo Costandi
    @mocost
    Thu 24 Mar 2016 10.30 EDT

    Researchers in the United States have developed a new method for controlling the brain circuits associated with complex animal behaviours, using genetic engineering to create a magnetised protein that activates specific groups of nerve cells from a distance.

    Understanding how the brain generates behaviour is one of the ultimate goals of neuroscience – and one of its most difficult questions. In recent years, researchers have developed a number of methods that enable them to remotely control specified groups of neurons and to probe the workings of neuronal circuits.

    The most powerful of these is a method called optogenetics, which enables researchers to switch populations of related neurons on or off on a millisecond-by-millisecond timescale with pulses of laser light. Another recently developed method, called chemogenetics, uses engineered proteins that are activated by designer drugs and can be targeted to specific cell types.

    Although powerful, both of these methods have drawbacks. Optogenetics is invasive, requiring insertion of optical fibres that deliver the light pulses into the brain and, furthermore, the extent to which the light penetrates the dense brain tissue is severely limited. Chemogenetic approaches overcome both of these limitations, but typically induce biochemical reactions that take several seconds to activate nerve cells.

    The new technique, developed in Ali Güler’s lab at the University of Virginia in Charlottesville, and described in an advance online publication in the journal Nature Neuroscience, is not only non-invasive, but can also activate neurons rapidly and reversibly.

    Several earlier studies have shown that nerve cell proteins which are activated by heat and mechanical pressure can be genetically engineered so that they become sensitive to radio waves and magnetic fields, by attaching them to an iron-storing protein called ferritin, or to inorganic paramagnetic particles. These methods represent an important advance – they have, for example, already been used to regulate blood glucose levels in mice – but involve multiple components which have to be introduced separately.

    The new technique builds on this earlier work, and is based on a protein called TRPV4, which is sensitive to both temperature and stretching forces. These stimuli open its central pore, allowing electrical current to flow through the cell membrane; this evokes nervous impulses that travel into the spinal cord and then up to the brain.

    Güler and his colleagues reasoned that magnetic torque (or rotating) forces might activate TRPV4 by tugging open its central pore, and so they used genetic engineering to fuse the protein to the paramagnetic region of ferritin, together with short DNA sequences that signal cells to transport proteins to the nerve cell membrane and insert them into it.



    In vivo manipulation of zebrafish behavior using Magneto. Zebrafish larvae exhibit coiling behaviour in response to localized magnetic fields. From Wheeler et al (2016).
    When they introduced this genetic construct into human embryonic kidney cells growing in Petri dishes, the cells synthesized the ‘Magneto’ protein and inserted it into their membrane. Application of a magnetic field activated the engineered TRPV1 protein, as evidenced by transient increases in calcium ion concentration within the cells, which were detected with a fluorescence microscope.

    Next, the researchers inserted the Magneto DNA sequence into the genome of a virus, together with the gene encoding green fluorescent protein, and regulatory DNA sequences that cause the construct to be expressed only in specified types of neurons. They then injected the virus into the brains of mice, targeting the entorhinal cortex, and dissected the animals’ brains to identify the cells that emitted green fluorescence. Using microelectrodes, they then showed that applying a magnetic field to the brain slices activated Magneto so that the cells produce nervous impulses.

    To determine whether Magneto can be used to manipulate neuronal activity in live animals, they injected Magneto into zebrafish larvae, targeting neurons in the trunk and tail that normally control an escape response. They then placed the zebrafish larvae into a specially-built magnetised aquarium, and found that exposure to a magnetic field induced coiling manouvres similar to those that occur during the escape response. (This experiment involved a total of nine zebrafish larvae, and subsequent analyses revealed that each larva contained about 5 neurons expressing Magneto.)

    In one final experiment, the researchers injected Magneto into the striatum of freely behaving mice, a deep brain structure containing dopamine-producing neurons that are involved in reward and motivation, and then placed the animals into an apparatus split into magnetised a non-magnetised sections. Mice expressing Magneto spent far more time in the magnetised areas than mice that did not, because activation of the protein caused the striatal neurons expressing it to release dopamine, so that the mice found being in those areas rewarding. This shows that Magneto can remotely control the firing of neurons deep within the brain, and also control complex behaviours.

    Neuroscientist Steve Ramirez of Harvard University, who uses optogenetics to manipulate memories in the brains of mice, says the study is “badass”.

    “Previous attempts [using magnets to control neuronal activity] needed multiple components for the system to work – injecting magnetic particles, injecting a virus that expresses a heat-sensitive channel, [or] head-fixing the animal so that a coil could induce changes in magnetism,” he explains. “The problem with having a multi-component system is that there’s so much room for each individual piece to break down.”

    “This system is a single, elegant virus that can be injected anywhere in the brain, which makes it technically easier and less likely for moving bells and whistles to break down,” he adds, “and their behavioral equipment was cleverly designed to contain magnets where appropriate so that the animals could be freely moving around.”

    ‘Magnetogenetics’ is therefore an important addition to neuroscientists’ tool box, which will undoubtedly be developed further, and provide researchers with new ways of studying brain development and function."

    Reference
    Wheeler, M. A., et al. (2016). Genetically targeted magnetic control of the nervous system. Nat. Neurosci., DOI: 10.1038/nn.4265 [Abstract]

    Quote Posted by thepainterdoug (here)
    perhaps a key relevant 2016 article from the Guardian UK that Dr Joseph Farrell recently took time to read to his audience.
    Could this be the connection to the magnetism, the Graphene Oxide and the mad push to get this into every arm ?

    https://www.theguardian.com/science/...-and-behaviour
    Each breath a gift...
    _____________

  22. The Following 16 Users Say Thank You to onawah For This Post:

    Alecs (31st July 2021), avid (31st July 2021), Bill Ryan (31st July 2021), bluestflame (2nd August 2021), BushPilot (4th August 2021), Ewan (1st August 2021), fifi (3rd August 2021), Gwin Ru (1st August 2021), Harmony (2nd August 2021), meat suit (31st July 2021), mountain_jim (31st July 2021), Pam (1st August 2021), pueblo (2nd August 2021), Reinhard (31st July 2021), Sue (Ayt) (31st July 2021), wondering (31st July 2021)

  23. Link to Post #92
    United States Moderator Sue (Ayt)'s Avatar
    Join Date
    23rd December 2016
    Language
    English
    Posts
    2,596
    Thanks
    28,786
    Thanked 20,909 times in 2,594 posts

    Default Re: Graphene in the 'vaccines'

    ELECTROMAGNETICS EXPERT BREAKS DOWN GRAPHENE OXIDE IN THE VAX, AND 'DELGADO'S BULL.'
    Q Clearance (Formerly) researcher and electromagnetics expert, Ginny Silcox, joins us once again to discuss an alarming connection - the ingredients in the vaccines, like Graphene Oxide, are turning peoples blood into living high receptivity antenna. And the implications are hellish.

    Source: https://www.bitchute.com/video/FyoQ7vQZymcC


    (Searching Ginny Silcox on PA brings her up in the past in our threads about the California Fires and energy weapons. Further searching her as "Virginia Silcox" does show that she was at one time a training specialist II for the DOE/NNSA Emergency Operations training academy.)
    "We're all bozos on this bus"

  24. The Following 10 Users Say Thank You to Sue (Ayt) For This Post:

    Alecs (2nd August 2021), avid (1st August 2021), Bill Ryan (2nd August 2021), BushPilot (4th August 2021), Constance (2nd August 2021), fifi (3rd August 2021), Gwin Ru (1st August 2021), Harmony (2nd August 2021), Pam (3rd August 2021), thepainterdoug (2nd August 2021)

  25. Link to Post #93
    Namibia Avalon Member Karezza's Avatar
    Join Date
    28th December 2012
    Location
    Multi-D Reality
    Language
    Flemish
    Posts
    76
    Thanks
    273
    Thanked 333 times in 68 posts

    Default Re: Graphene in the 'vaccines'

    Removal of NanoWorms Video - Amanita Mascaria - Alexander Nairanovsk Protocol

    Quote Amanita Mascaria or Fly agaric preparation. Here is what steps I take:

    1. Find Amanita Mascaria mushrooms and bring home only tops - hats.
    2. I take red skin off with white dots and then dry them really good - crispy. Cut in pieces.
    3. Wait 2 month and allow more ibotenic acit to evaporate.
    3. Boil (simmer) for 20 mintues on small stove fire.
    4. Yes, you can use lemon juice or citric acid. This helps to further remove ibotenic acid (which makes you throw up). Muscimol is left behind (good chemical).
    5. I them mix this tea liquid with fruits in blender: banana, strawberry, nuts, seeds, blueberries....anything you like to make it delicious. Those berries by the way can replace lemon juice. I stopped purchasing lemon here in Belarus, it is way to expensive nowadays, because of this new "disease".
    I hope this helps.
    Pure gum spirits of turpentine is useful in the removal of parasites. Looking at Glutathione and its precursor N-acetylcysteine to remove Grapene -PaulGKTW (in comments).
    "The artist takes in the world, but instead of being oppressed by it, reworks it in their own personality and recreates it in the work of art"

  26. The Following 5 Users Say Thank You to Karezza For This Post:

    BushPilot (4th August 2021), Harmony (2nd August 2021), Pam (2nd August 2021), pueblo (2nd August 2021), Reinhard (2nd August 2021)

  27. Link to Post #94
    Scotland Avalon Member greybeard's Avatar
    Join Date
    17th March 2010
    Location
    Inverness-----Scotland
    Language
    English
    Age
    78
    Posts
    13,356
    Thanks
    32,618
    Thanked 68,863 times in 11,839 posts

    Default Re: Graphene in the 'vaccines'

    the-vax-causes-the-virus-to-be-more-dangerous-mrna-vaccine-technology-inventor-warns


    https://new.awakeningchannel.com/the...nventor-warns/
    Be kind to all life, including your own, no matter what!!

  28. The Following 7 Users Say Thank You to greybeard For This Post:

    avid (2nd August 2021), BushPilot (4th August 2021), fifi (3rd August 2021), Harmony (3rd August 2021), Icare (2nd August 2021), Pam (3rd August 2021), thepainterdoug (2nd August 2021)

  29. Link to Post #95
    UK Avalon Member Sérénité's Avatar
    Join Date
    12th March 2013
    Language
    English
    Posts
    896
    Thanks
    3,644
    Thanked 9,094 times in 870 posts

    Default Re: Graphene in the 'vaccines'

    FORMER PFIZER EMPLOYEE CONFIRMS POISONOUS GRAPHENE OXIDE IN THE COVID JABS

    Former Pfizer employee Karen Kingston is interviewed here with her findings on Graphene oxide being in the vaccines...

    The fact checkers have been out in force saying it isn’t present in the ‘vaccines’ but her investigations prove it is.
    She breaks down in this interview, visibly distressed at what may happen to people being poisoned by the Graphene. She refused to go down the road if confirming it could be used once activated for mind control. But she does confirm it’s ability to be a conductor when exposed to an external source of emf.

    As a side note, I decided to research the origins of Graphene Oxide recently.
    Apologies if it’s mentioned in this thread previously, I need to go back and re read it all.

    But the two guys that originally discovered GO, Professor Andre Geim and Professor Kostya Novoselov, they now run the Graphene Institute here in Manchester, opened in c2015.
    And one of the guys, Andre Geim, has clear funding links coming from Bill & Melinda Gates Foundation.

    https://www.bitchute.com/video/3WagY494Nxnn/

    https://www.graphene.manchester.ac.uk/
    Last edited by Sérénité; 2nd August 2021 at 20:44.

  30. The Following 12 Users Say Thank You to Sérénité For This Post:

    bluestflame (3rd August 2021), BushPilot (4th August 2021), Constance (2nd August 2021), fifi (3rd August 2021), Gwin Ru (2nd August 2021), Harmony (3rd August 2021), Icare (2nd August 2021), mountain_jim (3rd August 2021), Pam (3rd August 2021), pueblo (3rd August 2021), Reinhard (4th August 2021), thepainterdoug (2nd August 2021)

  31. Link to Post #96
    Avalon Retired Member
    Join Date
    26th January 2011
    Language
    English
    Posts
    3,453
    Thanks
    20,718
    Thanked 25,438 times in 3,321 posts

    Default Re: Graphene in the 'vaccines'

    fffffffffffffffffffffffffffffffff
    Last edited by Constance; 14th November 2021 at 18:25.

  32. The Following 11 Users Say Thank You to Constance For This Post:

    bluestflame (3rd August 2021), BushPilot (4th August 2021), Gwin Ru (2nd August 2021), Harmony (3rd August 2021), Icare (2nd August 2021), melissanederland (3rd August 2021), Mike (2nd August 2021), Pam (3rd August 2021), Ravenlocke (3rd August 2021), Reinhard (4th August 2021), Sérénité (2nd August 2021)

  33. Link to Post #97
    UK Avalon Member Sérénité's Avatar
    Join Date
    12th March 2013
    Language
    English
    Posts
    896
    Thanks
    3,644
    Thanked 9,094 times in 870 posts

    Default Re: Graphene in the 'vaccines'

    That’s the one Constance, Thankyou.
    Seems Andre Geim is the one working with Bill Gates Foundation on the Graphene condoms. Not a location on the body you’d want wrapped in Graphene I’m sure. Sounds more like potential sterilisation that birth control to me!

  34. The Following 7 Users Say Thank You to Sérénité For This Post:

    bluestflame (3rd August 2021), Constance (3rd August 2021), Gwin Ru (3rd August 2021), Harmony (3rd August 2021), Karen (Geophyz) (3rd August 2021), Pam (3rd August 2021), Ravenlocke (3rd August 2021)

  35. Link to Post #98
    UK Avalon Member avid's Avatar
    Join Date
    19th March 2010
    Location
    NW UK
    Language
    English
    Posts
    2,897
    Thanks
    59,572
    Thanked 15,792 times in 2,667 posts

    Default Re: Graphene in the 'vaccines'

    Just found this disturbing article about GO use in water treatment.
    https://www.watertechonline.com/indu...1FyKml-mZoaWNg
    The love you withhold is the pain that you carry
    and er..
    "Chariots of the Globs" (apols to Fat Freddy's Cat)

  36. The Following 8 Users Say Thank You to avid For This Post:

    bluestflame (3rd August 2021), Gwin Ru (3rd August 2021), Harmony (3rd August 2021), Karen (Geophyz) (3rd August 2021), Matthew (3rd August 2021), Pam (3rd August 2021), Ravenlocke (3rd August 2021), Sue (Ayt) (3rd August 2021)

  37. Link to Post #99
    Avalon Member Eva2's Avatar
    Join Date
    31st January 2011
    Posts
    2,604
    Thanks
    10,085
    Thanked 22,808 times in 2,559 posts

    Default Re: Graphene in the 'vaccines'

    There are reports that this is being planned for Canada too - not sure what to do about the drinking water then if you are on the municipal supply system.


  38. The Following 8 Users Say Thank You to Eva2 For This Post:

    bluestflame (4th August 2021), BushPilot (4th August 2021), Gwin Ru (3rd August 2021), Harmony (4th August 2021), Karen (Geophyz) (3rd August 2021), Matthew (3rd August 2021), Ravenlocke (3rd August 2021), Sue (Ayt) (3rd August 2021)

  39. Link to Post #100
    Avalon Member Eva2's Avatar
    Join Date
    31st January 2011
    Posts
    2,604
    Thanks
    10,085
    Thanked 22,808 times in 2,559 posts

    Default Re: Graphene in the 'vaccines'

    https://smartwatermagazine.com/news/...sb6I4PlhdV1GBI
    'Milestone contract for graphene technology in water treatment'

    UK technology business awarded first commercial business contract for industrial wastewater treatment
    Graphene technology slashes energy costs and reduces fouling for water treatment
    Initial applications in commercial laundry, produced water, food, beverages and dairy industries
    30/07/2021

    About the entity

    G2O Water Technologies
    Companies
    121
    G2O Water Technologies
    G2O is a fast-growing technology business with a portfolio of products that reduce the cost and environmental impact of water treatment. Our products harness the transformational potential of 2D materials, such as Graphene Oxide.
    TwitterLinkedInWeb
    ACCIONA
    THEMES
    INDUSTRIAL | WATER TREATMENT
    UK technology business G2O Water Technologies has landed its first commercial contract for the enhancement of water filtration membranes with graphene oxide. This is particularly significant for both the technology company as well as the water sector globally, as it is the first commercially successful application of the recently developed “wonder” material for water treatment.

    The advantages of using graphene oxide lie in the enhancement of membrane performance, as it mitigates the effects of fouling – one of the biggest challenges operators of membrane-based water filtration systems face. With a coating of graphene oxide, successfully developed and piloted by the company in the northwest of England in collaboration with Hydrasyst Limited, operators can improve operational efficiency, reduce energy consumption and decrease chemical usage. It is anticipated that this will extend the lifetime of the membranes, as well as significantly reducing the cost and environmental impact of water treatment.

    Hydrasyst, the earliest adopter of the technology, is a British turnkey solution provider of advanced membrane technology systems, particularly in industrial processes. Commenting on its work with G2O, Managing Director Kyle Wolff stated, “We’re thrilled to have been closely involved for some time now with the piloting and application of G2O Water Technology’s graphene oxide coatings. They have ultimately succeeded in proving their value for some of the most difficult water treatment challenges our customers face; for example in the industrial laundry sector. With the graphene oxide coating, our ceramic hollow-fibre membrane systems deliver significant operational advantages, enabling end-users to enhance the efficiency of their water usage, whilst delivering significant savings in energy costs .”

    “This is a significant milestone for the company and the whole water sector. It’s the first commercially successful application of graphene oxide for water treatment”, said Chris Wyres, CEO of G2O Technologies. “The results of industrial trials with Hydrasyst validate the real-world advantages the solution delivers. We will be working closely with Hydrasyst to roll-out Nanopulse systems for a range of water treatment applications. We envisage that wide-scale deployment of this transformational solution can contribute to addressing the challenges of water scarcity and climate change.”

  40. The Following 3 Users Say Thank You to Eva2 For This Post:

    BushPilot (4th August 2021), Gwin Ru (4th August 2021), Harmony (5th August 2021)

+ Reply to Thread
Page 5 of 11 FirstFirst 1 5 11 LastLast

Tags for this Thread

Posting Permissions

  • You may not post new threads
  • You may not post replies
  • You may not post attachments
  • You may not edit your posts